KEGG   Homo sapiens (human): 3150Help
Entry
3150              CDS       T01001                                 

Gene name
HMGN1, HMG14
Definition
(RefSeq) high mobility group nucleosome binding domain 1
  KO
K11299  high-mobility group nucleosome-binding domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3150 (HMGN1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    3150 (HMGN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG14_17
Motif
Other DBs
NCBI-GeneID: 3150
NCBI-ProteinID: NP_004956
OMIM: 163920
HGNC: 4984
Ensembl: ENSG00000205581
Vega: OTTHUMG00000066178
Pharos: P05114(Tbio)
UniProt: P05114 Q6NSG7
Position
21q22.2
AA seq 100 aa AA seqDB search
MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKG
KQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaggaaggtcagctccgccgaaggcgccgccaaggaagagcccaagaggaga
tcggcgcggttgtcagctaaacctcctgcaaaagtggaagcgaagccgaaaaaggcagca
gcgaaggataaatcttcagacaaaaaagtgcaaacaaaagggaaaaggggagcaaaggga
aaacaggccgaagtggctaaccaagaaactaaagaagacttacctgcggaaaacggggaa
acgaagactgaggagagtccagcctctgatgaagcaggagagaaagaagccaagtctgat
taa

DBGET integrated database retrieval system