KEGG   Homo sapiens (human): 3437
Entry
3437              CDS       T01001                                 
Symbol
IFIT3, CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, P60, RIG-G, cig41
Name
(RefSeq) interferon induced protein with tetratricopeptide repeats 3
  KO
K24849  interferon-induced protein with tetratricopeptide repeats 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    3437 (IFIT3)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Tetratricopeptide repeat-containing proteins
   3437 (IFIT3)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_19 TPR_1 TPR_12 TPR_11 TPR_17 TPR_14 TPR_7 TPR_16 TPR_6 TPR_15 TPR_MalT NatA_aux_su Cohesin_load TPR-S ANAPC3 ChAPs
Other DBs
NCBI-GeneID: 3437
NCBI-ProteinID: NP_001026853
OMIM: 604650
HGNC: 5411
Ensembl: ENSG00000119917
Pharos: O14879(Tbio)
UniProt: O14879 Q5T765
Structure
Position
10:89327997..89340968
AA seq 490 aa
MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYI
KHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKV
KQTCKKFSNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAM
YHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQ
TDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA
SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNKEVPDAEKQQS
HQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPR
ELLSNSEQLN
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgagtgaggtcaccaagaattccctggagaaaatccttccacagctgaaatgccatttc
acctggaacttattcaaggaagacagtgtctcaagggatctagaagatagagtgtgtaac
cagattgaatttttaaacactgagttcaaagctacaatgtacaacttgttggcctacata
aaacacctagatggtaacaacgaggcagccctggaatgcttacggcaagctgaagagtta
atccagcaagaacatgctgaccaagcagaaatcagaagtctagtcacttggggaaactac
gcctgggtctactatcacttgggcagactctcagatgctcagatttatgtagataaggtg
aaacaaacctgcaagaaattttcaaatccatacagtattgagtattctgaacttgactgt
gaggaagggtggacacaactgaagtgtggaagaaatgaaagggcgaaggtgtgttttgag
aaggctctggaagaaaagcccaacaacccagaattctcctctggactggcaattgcgatg
taccatctggataatcacccagagaaacagttctctactgatgttttgaagcaggccatt
gagctgagtcctgataaccaatacgtcaaggttctcttgggcctgaaactgcagaagatg
aataaagaagctgaaggagagcagtttgttgaagaagccttggaaaagtctccttgccaa
acagatgtcctccgcagtgcagccaaattttacagaagaaaaggtgacctagacaaagct
attgaactgtttcaacgggtgttggaatccacaccaaacaatggctacctctatcaccag
attgggtgctgctacaaggcaaaagtaagacaaatgcagaatacaggagaatctgaagct
agtggaaataaagagatgattgaagcactaaagcaatatgctatggactattcgaataaa
gctcttgagaagggactgaatcctctgaatgcatactccgatctcgctgagttcctggag
acggaatgttatcagacaccattcaataaggaagtccctgatgctgaaaagcaacaatcc
catcagcgctactgcaaccttcagaaatataatgggaagtctgaagacactgctgtgcaa
catggtttagagggtttgtccataagcaaaaaatcaactgacaaggaagagatcaaagac
caaccacagaatgtatctgaaaatctgcttccacaaaatgcaccaaattattggtatctt
caaggattaattcataagcagaatggagatctgctgcaagcagccaaatgttatgagaag
gaactgggccgcctgctaagggatgccccttcaggcataggcagtattttcctgtcagca
tctgagcttgaggatggtagtgaggaaatgggccagggcgcagtcagctccagtcccaga
gagctcctctctaactcagagcaactgaactga

DBGET integrated database retrieval system