KEGG   Homo sapiens (human): 348654Help
Entry
348654            CDS       T01001                                 

Gene name
GEN1, Gen
Definition
(RefSeq) GEN1 Holliday junction 5' flap endonuclease
  KO
K15338  flap endonuclease GEN [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    348654 (GEN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     348654 (GEN1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     348654 (GEN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I Chromo_2 XPG_N SpoU_methylas_C
Motif
Other DBs
NCBI-GeneID: 348654
NCBI-ProteinID: NP_001123481
OMIM: 612449
HGNC: 26881
Ensembl: ENSG00000178295
Vega: OTTHUMG00000121173
Pharos: Q17RS7(Tbio)
UniProt: Q17RS7
Structure
PDB: 

Position
2p24.2
AA seq 908 aa AA seqDB search
MGVNDLWQILEPVKQHIPLRNLGGKTIAVDLSLWVCEAQTVKKMMGSVMKPHLRNLFFRI
SYLTQMDVKLVFVMEGEPPKLKADVISKRNQSRYGSSGKSWSQKTGRSHFKSVLRECLHM
LECLGIPWVQAAGEAEAMCAYLNAGGHVDGCLTNDGDTFLYGAQTVYRNFTMNTKDPHVD
CYTMSSIKSKLGLDRDALVGLAILLGCDYLPKGVPGVGKEQALKLIQILKGQSLLQRFNR
WNETSCNSSPQLLVTKKLAHCSVCSHPGSPKDHERNGCRLCKSDKYCEPHDYEYCCPCEW
HRTEHDRQLSEVENNIKKKACCCEGFPFHEVIQEFLLNKDKLVKVIRYQRPDLLLFQRFT
LEKMEWPNHYACEKLLVLLTHYDMIERKLGSRNSNQLQPIRIVKTRIRNGVHCFEIEWEK
PEHYAMEDKQHGEFALLTIEEESLFEAAYPEIVAVYQKQKLEIKGKKQKRIKPKENNLPE
PDEVMSFQSHMTLKPTCEIFHKQNSKLNSGISPDPTLPQESISASLNSLLLPKNTPCLNA
QEQFMSSLRPLAIQQIKAVSKSLISESSQPNTSSHNISVIADLHLSTIDWEGTSFSNSPA
IQRNTFSHDLKSEVESELSAIPDGFENIPEQLSCESERYTANIKKVLDEDSDGISPEEHL
LSGITDLCLQDLPLKERIFTKLSYPQDNLQPDVNLKTLSILSVKESCIANSGSDCTSHLS
KDLPGIPLQNESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRK
VDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKL
SSPKIHIKETEQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLRQR
LKLRFQST
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaatgacttgtggcaaattttggagcctgttaagcaacacatccccttgcgt
aatcttggtgggaaaaccattgcagttgatctgagtctctgggtgtgtgaggcacagaca
gtcaaaaaaatgatgggcagcgtcatgaagccccacctcaggaacttattttttcgtatc
tcatatttaacacaaatggatgtaaaactggtatttgttatggaaggggaaccaccaaag
ctgaaagctgatgtcataagcaagaggaatcagtctcggtatgggtcttctggaaaatcg
tggtctcagaaaacagggagatcacattttaaatcagtcttaagagagtgcctccatatg
ctcgaatgcttaggaatcccctgggttcaggctgctggggaagctgaagccatgtgtgct
tatctcaatgctggtggtcatgtcgatggctgcctcaccaatgatggagatactttcctt
tatggggcccagactgtttacaggaatttcactatgaatacaaaggacccacatgttgac
tgttacacaatgtcatctatcaagagtaaactaggtttggatagagatgctctggttgga
ttagcaatacttcttggctgtgattatctcccaaagggagtccctggagttggaaaagag
caagcattaaaacttatacagattttgaaagggcaaagtttacttcagaggtttaatcgg
tggaatgaaacatcttgtaactctagtccacaactgctagtcactaaaaaactggctcat
tgttccgtatgttcccatccaggttcacctaaggatcatgaacgtaatggatgcagatta
tgtaaaagtgataaatattgtgagccacatgactatgaatactgctgtccttgtgagtgg
caccgtacagaacatgataggcaactcagtgaagtagagaacaatattaagaagaaagct
tgctgttgtgagggattcccattccatgaggttattcaagaattccttttaaacaaggat
aaattggtgaaggttatcaggtaccaaagacctgatttgttattgtttcagagatttact
cttgaaaaaatggagtggcccaatcactatgcatgtgagaaattgctggtacttttgacc
cattatgacatgatagaaagaaagcttggtagcagaaactctaatcaactacagccaatt
cgaattgttaagactcgaatcagaaatggagttcattgttttgaaatagaatgggaaaag
cctgaacattatgctatggaagataaacaacatggagaatttgctttattaacaattgag
gaagaatcattgtttgaagcagcatatcctgagatcgttgctgtttaccaaaaacaaaag
ttagaaattaaagggaagaaacaaaaacgtattaagcctaaagaaaacaatttgccagaa
ccagatgaagtaatgagctttcagtcacacatgactttaaaacccacatgtgaaatcttt
cataagcagaattccaagttaaattcggggatttcccctgatcctacattaccacaggaa
tctatttctgcctcattgaatagcttgcttttacctaaaaatactccatgtttgaatgca
caagaacagttcatgtcttctctaagacctttggctatacagcaaattaaagctgtcagt
aagtctctaatttcagaatctagtcaacccaatacctcatctcataatatatccgtgatt
gctgatctacacttgagcactattgactgggaaggtacttcttttagtaattctccagct
attcaaaggaatactttttctcatgatttaaaatcagaagttgaatcagagctatcagcc
atccctgatggctttgaaaatatcccagaacaactgtcctgtgaatcagaaaggtacact
gcaaacataaagaaagtgttggatgaggattctgatgggattagtcctgaagagcatcta
ctttctggcattactgatttatgtcttcaggatttgcctttaaaggaacgaatatttaca
aaattatcatatcctcaggataatctacaaccagatgtcaacctgaaaactttgtccata
cttagtgtaaaagaatcttgtattgctaacagtggttctgattgtacatcacatctttca
aaggatcttccaggaattcccttgcaaaatgaatccagagactctaaaattctaaaagga
gaccagctgcttcaagaagactataaagtcaatacttctgtcccttattctgtcagtaac
acagtggtaaagacctgcaatgttagaccaccaaatactgctttagatcatagtagaaaa
gttgatatgcaaaccactcggaaaattttaatgaagaagagtgtttgccttgacagacat
tcctctgatgaacaaagtgccccagtgtttgggaaagctaagtacacaactcaaagaatg
aagcacagttctcaaaagcataattcatcccatttcaaagaaagtggccataacaagttg
agtagccctaagatacatattaaagaaactgaacagtgtgtcagatcttatgaaacagct
gaaaatgaagaaagctgtttcccagattcaacaaaaagttctctgagttctctacaatgt
cataagaaagaaaacaactctggtacttgtttggatagccctcttcctttacgccagaga
ttaaaactaagattccaaagcacttga

DBGET integrated database retrieval system