KEGG   Homo sapiens (human): 3572Help
Entry
3572              CDS       T01001                                 

Gene name
IL6ST, CD130, CDW130, GP130, IL-6RB
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00181  KSHV vIL-6 to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3572 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3572 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3572 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    3572 (IL6ST)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3572 (IL6ST)
   05203 Viral carcinogenesis
    3572 (IL6ST)
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    3572 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3572 (IL6ST)
   04090 CD molecules [BR:hsa04090]
    3572 (IL6ST)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   3572 (IL6ST)
CD molecules [BR:hsa04090]
 Proteins
  3572 (IL6ST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Lep_receptor_Ig EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2
Motif
Other DBs
NCBI-GeneID: 3572
NCBI-ProteinID: NP_002175
OMIM: 600694
HGNC: 6021
Ensembl: ENSG00000134352
Vega: OTTHUMG00000097043
Pharos: P40189(Tclin)
UniProt: P40189 Q17RA0
Structure
PDB: 

Position
5q11.2
AA seq 918 aa AA seqDB search
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgttgcagacttggctagtgcaagccttgtttattttcctcaccactgaatct
acaggtgaacttctagatccatgtggttatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgctaattacattgtctggaaaacaaaccattttactattcctaaggagcaatatact
atcataaacagaacagcatccagtgtcacctttacagatatagcttcattaaatattcag
ctcacttgcaacattcttacattcggacagcttgaacagaatgtttatggaatcacaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaacgaggggaag
aaaatgaggtgtgagtgggatggtggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttgctgattgcaaagcaaaacgtgacacccccacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatatcaattttgatcctgtatataaagtg
aagcccaatccgccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaattgacatggaccaacccaagtattaagagtgttataatactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattcctcctgaagacacagcatccacc
cgatcttcattcactgtccaagaccttaaaccttttacagaatatgtgtttaggattcgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaagtgggatc
acctatgaagatagaccatctaaagcaccaagtttctggtataaaatagatccatcccat
actcaaggctacagaactgtacaactcgtgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacatttacaaaattac
acagttaatgccacaaaactgacagtaaatctcacaaatgatcgctatctagcaacccta
acagtaagaaatcttgttggcaaatcagatgcagctgttttaactatccctgcctgtgac
tttcaagctactcaccctgtaatggatcttaaagcattccccaaagataacatgctttgg
gtggaatggactactccaagggaatctgtaaagaaatatatacttgagtggtgtgtgtta
tcagataaagcaccctgtatcacagactggcaacaagaagatggtaccgtgcatcgcacc
tatttaagagggaacttagcagagagcaaatgctatttgataacagttactccagtatat
gctgatggaccaggaagccctgaatccataaaggcataccttaaacaagctccaccttcc
aaaggacctactgttcggacaaaaaaagtagggaaaaacgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacattgtcc
tctttgactagtgacacattgtacatggtacgaatggcagcatacacagatgaaggtggg
aaggatggtccagaattcacttttactaccccaaagtttgctcaaggagaaattgaagcc
atagtcgtgcctgtttgcttagcattcctattgacaactcttctgggagtgctgttctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacactcctccaaggcacaattttaattcaaaagat
caaatgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgac
aaaaagccttttccagaagatctgaaatcattggacctgttcaaaaaggaaaaaattaat
actgaaggacacagcagtggtattggggggtcttcatgcatgtcatcttctaggccaagc
atttctagcagtgatgaaaatgaatcttcacaaaacacttcgagcactgtccagtattct
accgtggtacacagtggctacagacaccaagttccgtcagtccaagtcttctcaagatcc
gagtctacccagcccttgttagattcagaggagcggccagaagatctacaattagtagat
catgtagatggcggtgatggtattttgcccaggcaacagtacttcaaacagaactgcagt
cagcatgaatccagtccagatatttcacattttgaaaggtcaaagcaagtttcatcagtc
aatgaggaagattttgttagacttaaacagcagatttcagatcatatttcacaatcctgt
ggatctgggcaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtccaggt
actgagggacaagtagaaagatttgaaacagttggcatggaggctgcgactgatgaaggc
atgcctaaaagttacttaccacagactgtacggcaaggcggctacatgcctcagtga

DBGET integrated database retrieval system