KEGG   Homo sapiens (human): 3659Help
Entry
3659              CDS       T01001                                 

Gene name
IRF1, IRF-1, MAR
Definition
(RefSeq) interferon regulatory factor 1
  KO
K09444  interferon regulatory factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04917  Prolactin signaling pathway
hsa05133  Pertussis
hsa05165  Human papillomavirus infection
Network
nt06123  TNF signaling (viruses and bacteria)
nt06166  Human papillomavirus (HPV)
  Element
N00374  TNF-IRF1 signaling pathway
N00375  HPV E7 to TNF-IRF1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    3659 (IRF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    3659 (IRF1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    3659 (IRF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    3659 (IRF1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3659 (IRF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3659 (IRF1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3659 (IRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF
Motif
Other DBs
NCBI-GeneID: 3659
NCBI-ProteinID: NP_002189
OMIM: 147575
HGNC: 6116
Ensembl: ENSG00000125347
Vega: OTTHUMG00000059497
Pharos: P10914(Tbio)
UniProt: P10914 Q6FHN8
Position
5q31.1
AA seq 325 aa AA seqDB search
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR
KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT
PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL
LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
MDATWLDSLLTPVRLPSIQAIPCAP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcactcggatgcgcatgagaccctggctagagatgcagattaattccaaccaa
atcccggggctcatctggattaataaagaggagatgatcttccagatcccatggaagcat
gctgccaagcatggctgggacatcaacaaggatgcctgtttgttccggagctgggccatt
cacacaggccgatacaaagcaggggaaaaggagccagatcccaagacgtggaaggccaac
tttcgctgtgccatgaactccctgccagatatcgaggaggtgaaagaccagagcaggaac
aagggcagctcagctgtgcgagtgtaccggatgcttccacctctcaccaagaaccagaga
aaagaaagaaagtcgaagtccagccgagatgctaagagcaaggccaagaggaagtcatgt
ggggattccagccctgataccttctctgatggactcagcagctccactctgcctgatgac
cacagcagctacacagttccaggctacatgcaggacttggaggtggagcaggccctgact
ccagcactgtcgccatgtgctgtcagcagcactctccccgactggcacatcccagtggaa
gttgtgccggacagcaccagtgatctgtacaacttccaggtgtcacccatgccctccacc
tctgaagctacaacagatgaggatgaggaagggaaattacctgaggacatcatgaagctc
ttggagcagtcggagtggcagccaacaaacgtggatgggaaggggtacctactcaatgaa
cctggagtccagcccacctctgtctatggagactttagctgtaaggaggagccagaaatt
gacagcccagggggggatattgggctgagtctacagcgtgtcttcacagatctgaagaac
atggatgccacctggctggacagcctgctgaccccagtccggttgccctccatccaggcc
attccctgtgcaccgtag

DBGET integrated database retrieval system