KEGG   Homo sapiens (human): 3739Help
Entry
3739              CDS       T01001                                 

Gene name
KCNA4, HBK4, HK1, HPCN2, HUKII, KCNA4L, KCNA8, KV1.4, MCIDDS, PCN2
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 4
  KO
K04877  potassium voltage-gated channel Shaker-related subfamily A member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
Drug target
Amifampridine: D10228 D10689
Fampridine: D04127
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    3739 (KCNA4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    3739 (KCNA4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3739 (KCNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans K_channel_TID BTB_2 Ion_trans_2 DctQ PKD_channel
Motif
Other DBs
NCBI-GeneID: 3739
NCBI-ProteinID: NP_002224
OMIM: 176266
HGNC: 6222
Ensembl: ENSG00000182255
Vega: OTTHUMG00000166144
Pharos: P22459(Tclin)
UniProt: P22459
Structure
PDB: 

Position
11p14.1
AA seq 653 aa AA seqDB search
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRE
LSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVI
NVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGR
LKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYP
ESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGLLNDTSAPHLE
NSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLG
TDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGL
LIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIV
GSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSS
TSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgcaatggtgagtgcggagagctcagggtgcaacagtcacatgccttatggt
tatgctgcccaggcccgggcccgggagcgggagaggcttgctcactccagggcagctgca
gcagctgctgttgcagcggccacagctgctgtcgaaggtagcgggggttctggtgggggc
tcccaccaccaccaccagtcacgcggggcctgtacctcccatgaccctcagagcagccgg
ggtagtcggaggaggaggcgacagcggtctgagaagaagaaagcccactaccggcagagc
agcttccctcattgctctgacctgatgcccagtggctctgaggagaagatcctgagggag
ctgagtgaggaggaggaagatgaggaggaggaggaagaggaggaagaggagggaaggttt
tactatagtgaagatgaccatggtgatgagtgttcctacacggatctgctgcctcaggat
gagggcggtggcggctacagttcagtccgctacagtgactgttgtgaacgtgtggtgata
aatgtgtcaggcctacgctttgagacccaaatgaaaactctggcccagtttccagagact
ttgttgggagaccctgaaaagaggactcagtactttgaccctttgcgcaatgagtatttt
tttgacaggaaccgccccagctttgatgccatcttgtattattatcaatcaggaggccgc
ctgaagaggccagtcaatgtcccctttgatatcttcactgaggaggtgaagttctatcag
ttgggggaggaggccctgttgaagtttcgggaggacgagggctttgtgagagaagaggaa
gacagggccctccccgagaatgaatttaaaaagcagatttggctcctctttgaatatcca
gagagctccagtcctgcaaggggcatagccattgtgtccgtcctggtcatcttaatctcc
attgtcatcttttgcctggaaaccttgcctgagtttagggacgacagggatctcgtcatg
gcactgagtgctggcgggcatggtgggttgttgaatgatacttcagcaccccatctggag
aactcagggcacacaatattcaatgaccccttcttcatcgtggaaacagtctgtattgta
tggttttcctttgagtttgtggttcgctgctttgcttgtcccagccaagcactcttcttc
aaaaacatcatgaacatcattgacattgtctccattttgccttacttcatcacactgggc
actgacctggcccagcaacaggggggtggcaatggtcagcagcagcaggccatgtccttt
gccatcctcagaatcattcgtctggtccgagtattccggatcttcaaactctccaggcac
tccaaaggcctgcagatcctgggccacaccctcagagccagcatgcgggaactgggcctt
ctgatcttcttcctcttcattggggtcatcctcttttctagtgctgtgtattttgcagag
gcggatgaacctactacccatttccaaagcatcccagatgcattttggtgggctgtggtg
accatgacaactgtgggctatggggacatgaagcccatcactgtagggggcaagattgtc
gggtccctgtgtgccattgcgggtgtcttaaccattgctttgccagtgccagtgattgtc
tctaactttaactatttctaccacagagagactgaaaatgaggaacagacacagctaacg
cagaatgcagtcagttgtccatacctcccctctaatttgctcaagaaatttcggagctct
acttcttcttccctgggggacaagtcagagtatctagagatggaagaaggagttaaggaa
tctctgtgtgcaaaggaggagaagtgtcagggaaagggggatgacagtgagacagataaa
aacaactgttctaatgcaaaggctgtggagactgatgtgtga

DBGET integrated database retrieval system