KEGG   Homo sapiens (human): 3930
Entry
3930              CDS       T01001                                 
Symbol
LBR, C14SR, DHCR14B, LMN2R, PHA, PHASK, TDRD18
Name
(RefSeq) lamin B receptor
  KO
K19532  Delta14-sterol reductase (lamin-B receptor) [EC:1.3.1.70]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa01100  Metabolic pathways
hsa04820  Cytoskeleton in muscle cells
Module
hsa_M00101  Cholesterol biosynthesis, FPP => cholesterol
Network
nt06034  Cholesterol biosynthesis
nt06539  Cytoskeleton in muscle cells
  Element
N01624  Cholesterol biosynthesis
N01822  Linker of nucleoskeleton and cytoskeleton (LINC) complex
Disease
H00234  Pelger-Huet anomaly
H00447  HEM skeletal dysplasia
H01133  Reynolds syndrome
H02732  Rhizomelic skeletal dysplasia with or without Pelger-Huet anomaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    3930 (LBR)
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    3930 (LBR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3930 (LBR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     3930 (LBR)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    3930 (LBR)
SSDB
Motif
Pfam: ERG4_ERG24 LBR_tudor DUF1295 ICMT PTM_DIR17_Tudor Tudor_3 PEMT
Other DBs
NCBI-GeneID: 3930
NCBI-ProteinID: NP_002287
OMIM: 600024
HGNC: 6518
Ensembl: ENSG00000143815
UniProt: Q14739
Structure
Position
1:complement(225401502..225428821)
AA seq 615 aa
MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSF
RQRKGGSTSSSPSRRRGSRSRSRSRSPGRPPKSARRSASASHQADIKEARREVEVKLTPL
ILKPFGNSISRYNGEPEHIERNDAPHKNTQEKFSLSQESSYIATQYSLRPRREEVKLKEI
DSKEEKYVAKELAVRTFEVTPIRAKDLEFGGVPGVFLIMFGLPVFLFLLLLMCKQKDPSL
LNFPPPLPALYELWETRVFGVYLLWFLIQVLFYLLPIGKVVEGTPLIDGRRLKYRLNGFY
AFILTSAVIGTSLFQGVEFHYVYSHFLQFALAATVFCVVLSVYLYMRSLKAPRNDLSPAS
SGNAVYDFFIGRELNPRIGTFDLKYFCELRPGLIGWVVINLVMLLAEMKIQDRAVPSLAM
ILVNSFQLLYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFIYSFQAFYLVSHPN
EVSWPMASLIIVLKLCGYVIFRGANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWW
GFVRHPNYLGDLIMALAWSLPCGFNHILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWE
KYCQRVPYRIFPYIY
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgccaagtaggaaatttgccgatggtgaagtggtaagaggtcgatggcctgggagttca
ctttattatgaagtagaaattctgagccacgacagcacctcccagctttacactgtgaag
tataaagatggaacagagcttgaattgaaagagaatgatattaagcctttaacttccttt
aggcaaaggaaaggtggctcaacttccagttccccttccagacgccgagggagtcgatca
aggtcacgctcccgatcccctggtcgaccacctaaaagtgcccgccgatctgcttctgct
tcccaccaggccgacattaaggaagcaaggagggaagtggaagttaaattgactccgctg
attctgaagccatttggaaatagcatcagcagatataatggggagcctgagcatattgag
agaaatgacgcacctcataaaaatacacaggaaaaattcagtttgtcacaagaaagcagt
tacatagcaacacagtatagccttcgtccaagaagagaagaagtcaaattaaaagaaata
gattctaaggaagaaaaatacgttgcaaaagaactggcagtgagaacctttgaagtgacc
cccatccgggcaaaggacttggagtttggaggagtacctggtgtgtttctcatcatgttt
ggcctgcctgtgttcctcttcctgttgctgttgatgtgtaaacagaaagatcccagtctt
ctgaatttccctcctcctttgccagctttgtatgagttatgggaaaccagagtatttggg
gtctacctcctgtggtttttgattcaagtcctgttctacctactgccaattggaaaggtt
gtagaaggaacgcctcttattgatggaagaagactcaagtatagattaaatggattctat
gcttttatcctgacatctgcagtcatcggaacatctctcttccagggcgtagagtttcat
tacgtgtacagtcattttcttcagtttgcacttgcggccactgttttttgtgtggtcttg
agtgtgtatctctacatgcgctctttgaaagcgccccggaatgacctgtcgcctgccagc
tctggaaatgctgtctatgatttcttcattggccgtgaattaaaccctcgaattggtact
tttgatctcaaatacttttgtgaattgcgccccggattgattggatgggtggttattaac
ttggtgatgcttttggctgaaatgaaaatacaggaccgcgctgttccatccttggccatg
attttagttaatagtttccagcttctctatgtggtggatgctctctggaatgaggaagcg
ttgttgacgaccatggacatcatccacgatggatttggattcatgctggcttttggagac
ttggtgtgggttccctttatttacagcttccaagccttttatttagtcagtcatccaaat
gaagtgtcttggccaatggcttctctaattattgttctgaaactttgtggttatgtaatc
ttccgaggtgcaaattctcagaaaaatgcattccggaaaaatcccagtgatccaaagctt
gcacatttaaaaaccattcatacttcaacgggaaaaaatcttctagtttctggatggtgg
ggctttgttcgccaccccaattacttgggtgatctcatcatggccttggcgtggtccctc
ccatgtggttttaaccacattctgccttatttctacataatttatttcaccatgttgctt
gtccaccgagaagctcgtgacgagtaccactgtaagaagaaatacggcgtggcttgggaa
aagtactgtcagcgtgtgccctaccgtatatttccatacatctactaa

DBGET integrated database retrieval system