KEGG   Homo sapiens (human): 40Help
Entry
40                CDS       T01001                                 

Gene name
ASIC2, ACCN, ACCN1, ASIC2a, BNC1, BNaC1, MDEG, hBNaC1
Definition
(RefSeq) acid sensing ion channel subunit 2
  KO
K04828  acid-sensing ion channel 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    40 (ASIC2)
   04750 Inflammatory mediator regulation of TRP channels
    40 (ASIC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    40 (ASIC2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   40 (ASIC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC
Motif
Other DBs
NCBI-GeneID: 40
NCBI-ProteinID: NP_001085
OMIM: 601784
HGNC: 99
Ensembl: ENSG00000108684
Vega: OTTHUMG00000132885
Pharos: Q16515(Tbio)
UniProt: Q16515
Position
17q11.2-q12
AA seq 512 aa AA seqDB search
MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVES
SERVSYYFSYQHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVN
LQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGH
QDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTF
EAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFP
VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLC
RTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVS
TCDTMPNHSETISHTVNVPLQTTLGTLEEIAC
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaaggaaagccccagtgagggcagcctgcaaccttctagcatccagatcttt
gccaacacctccaccctccatggcatccgccacatcttcgtgtatgggccgctgaccatc
cggcgtgtgctgtgggcagtggccttcgtgggctctctgggcctgctgctggtggagagc
tctgagagggtgtcctactacttctcctaccagcatgtcactaaggtggacgaagtggtg
gctcaaagcctggtcttcccagctgtgaccctctgtaacctgaatggcttccggttctcc
aggctcaccaccaatgacctgtaccatgctggggagctgctggccctgctggatgtcaac
ctgcagatcccggacccccatctggctgacccctccgtgctggaggccctgcggcagaag
gccaacttcaagcactacaaacccaagcagttcagcatgctggagttcctgcaccgtgtg
ggccatgacctgaaggatatgatgctctactgcaagttcaaagggcaggagtgcggccac
caagacttcaccacagtgtttacaaaatatgggaagtgttacatgtttaactcaggcgag
gatggcaaacctctgctcaccacggtcaagggggggacaggcaacgggctggagatcatg
ctggacattcagcaggatgagtacctgcccatctggggagagacagaggaaacgacattt
gaagcaggagtgaaagttcagatccacagtcagtctgagccacctttcatccaagagctg
ggctttggggtggctccagggttccagacctttgtggccacacaggagcagaggctcaca
tacctgcccccaccgtggggtgagtgccgatcctcagagatgggcctcgacttttttcct
gtttacagcatcaccgcctgtaggattgactgtgagacccgctacattgtggaaaactgc
aactgccgcatggttcacatgccaggggatgcccctttttgtacccctgagcagcacaag
gagtgtgcagagcctgccctaggtctgttggcggaaaaggacagcaattactgtctctgc
aggacaccctgcaacctaacccgctacaacaaagagctctccatggtgaagatccccagc
aagacatcagccaagtaccttgagaagaaatttaacaaatcagaaaaatatatctcagag
aacatccttgttctggatatattttttgaagctctcaattatgagacaattgaacagaag
aaggcgtatgaagttgctgccttacttggtgatattggtggtcagatgggattgttcatt
ggtgctagtatccttacaatactagagctctttgattatatttatgagctgatcaaagag
aagctattagacctgcttggcaaagaggaggacgaagggagccacgatgagaatgtgagt
acttgtgacacaatgccaaaccactctgaaaccatcagtcacactgtgaacgtgcccctg
cagacgaccctggggaccttggaggagattgcctgctga

DBGET integrated database retrieval system