KEGG   Homo sapiens (human): 4143Help
Entry
4143              CDS       T01001                                 

Gene name
MAT1A, MAT, MATA1, SAMS, SAMS1
Definition
(RefSeq) methionine adenosyltransferase 1A
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Module
hsa_M00034  Methionine salvage pathway
hsa_M00035  Methionine degradation
Disease
H00184  Hypermethioninemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4143 (MAT1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     4143 (MAT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N AdoMet_Synthase
Motif
Other DBs
NCBI-GeneID: 4143
NCBI-ProteinID: NP_000420
OMIM: 610550
HGNC: 6903
Ensembl: ENSG00000151224
Vega: OTTHUMG00000018613
Pharos: Q00266(Tbio)
UniProt: Q00266
Structure
PDB: 

Position
10q22.3
AA seq 395 aa AA seqDB search
MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVC
KTGMVLLCGEITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQC
VHLDRNEEDVGAGDQGLMFGYATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDS
KTQVTVQYMQDNGAVIPVRIHTIVISVQHNEDITLEEMRRALKEQVIRAVVPAKYLDEDT
VYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARW
VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVHKNFDLRPGVI
VRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKLVF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaccggtggatggcttgtgtgaccactctctaagtgaaggagtcttcatgttc
acatcggagtctgtgggagagggacacccggataagatctgtgaccagatcagtgatgca
gtgctggatgcccatctcaagcaagaccccaatgccaaggtggcctgtgagacagtgtgc
aagaccggcatggtgctgctgtgtggtgagatcacctcaatggccatggtggactaccag
cgggtggtgagggacaccatcaagcacatcggctacgatgactcagccaagggctttgac
ttcaagacttgcaacgtgctggtggctttggagcagcaatccccagatattgcccagtgc
gtccatctggacagaaatgaggaggatgtgggggcaggagatcagggtttgatgttcggc
tatgctaccgacgagacagaggagtgcatgcccctcaccatcatccttgctcacaagctc
aacgcccggatggcagacctcaggcgctccggcctcctcccctggctgcggcctgactct
aagactcaggtgacagttcagtacatgcaggacaatggcgcagtcatccctgtgcgcatc
cacaccatcgtcatctctgtgcagcacaacgaagacatcacgctggaggagatgcgcagg
gccctgaaggagcaagtcatcagggccgtggtgccggccaagtacctggacgaagacacc
gtctaccacctgcagcccagtgggcggtttgtcatcggaggtccccagggggatgcgggt
gtcactggccgtaagattattgtggacacctatggcggctggggggctcatggtggtggg
gccttctctgggaaggactacaccaaggtagaccgctcagctgcatatgctgcccgctgg
gtggccaagtctctggtgaaagcagggctctgccggagagtgcttgtccaggtttcctat
gccattggtgtggccgagccgctgtccatttccatcttcacctacggaacctctcagaag
acagagcgagagctgctggatgtggtgcataagaacttcgacctccggccgggcgtcatt
gtcagggatttggacttgaagaagcccatctaccagaagacagcatgctacggccatttc
ggaagaagcgagttcccatgggaggttcccaggaagcttgtattttag

DBGET integrated database retrieval system