KEGG   Homo sapiens (human): 4249Help
Entry
4249              CDS       T01001                                 

Gene name
MGAT5, GNT-V, GNT-VA, MGAT5A, glcNAc-T_V
Definition
(RefSeq) alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase
  KO
K00744  alpha-1,3(6)-mannosylglycoprotein beta-1,6-N-acetyl-glucosaminyltransferase [EC:2.4.1.155]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4249 (MGAT5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    4249 (MGAT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.155  alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase
     4249 (MGAT5)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   4249 (MGAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_18 DUF4525
Motif
Other DBs
NCBI-GeneID: 4249
NCBI-ProteinID: NP_002401
OMIM: 601774
HGNC: 7049
Ensembl: ENSG00000152127
Vega: OTTHUMG00000131681
Pharos: Q09328(Tbio)
UniProt: Q09328
Structure
PDB: 

Position
2q21.2-q21.3
AA seq 741 aa AA seqDB search
MALFTPWKLSSQKLGFFLVTFGFIWGMMLLHFTIQQRTQPESSSMLREQILDLSKRYIKA
LAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVVNGTGTNSTNST
TAVPSLVALEKINVADIINGAQEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDG
STCSFFIYLSEVENWCPHLPWRAKNPYEEADHNSLAEIRTDFNILYSMMKKHEEFRWMRL
RIRRMADAWIQAIKSLAEKQNLEKRKRKKVLVHLGLLTKESGFKIAETAFSGGPLGELVQ
WSDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPTVGDRIVELIYIDIVGLAQFK
KTLGPSWVHYQCMLRVLDSFGTEPEFNHANYAQSKGHKTPWGKWNLNPQQFYTMFPHTPD
NSFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVY
GSSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFN
PPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNQEEVEDAVKAILNQKIE
PYMPYEFTCEGMLQRINAFIEKQDFCHGQVMWPPLSALQVKLAEPGQSCKQVCQESQLIC
EPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRH
QRVCPCRDFIKGQVALCKDCL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggctctcttcactccgtggaagttgtcctctcagaagctgggctttttcctggtgact
tttggcttcatttggggtatgatgcttctgcactttaccatccagcagcgaactcagcct
gaaagcagctccatgctgcgcgagcagatcctggacctcagcaaaaggtacatcaaggca
ctggcagaagaaaacaggaatgtggtggatgggccatacgctggagtcatgacagcttat
gatctgaagaaaacccttgctgtgttattagataacattttgcagcgcattggcaagttg
gagtcgaaggtggacaatcttgttgtcaatggcaccggaacaaactcaaccaactccact
acagctgttcccagcttggttgcacttgagaaaattaatgtggcagatatcattaacgga
gctcaagaaaaatgtgtattgcctcctatggacggctaccctcactgtgagggaaagatc
aagtggatgaaagacatgtggcgttcagatccctgctacgcagactatggagtggatgga
tccacctgctctttttttatttacctcagtgaggttgaaaattggtgtcctcatttacct
tggagagcaaaaaatccctacgaagaagctgatcataattcattggcggaaattcgtaca
gattttaatattctctacagtatgatgaaaaagcatgaagaattccggtggatgagacta
cggatccggcgaatggctgacgcatggatccaagcaatcaagtccctggcagaaaagcag
aaccttgaaaagagaaagcggaagaaagtcctcgttcacctgggactcctgaccaaggaa
tctggatttaagattgcagagacagctttcagtggtggccctcttggtgaattagttcaa
tggagtgatttaattacatctctgtacttactgggccatgacattaggatttcagcttca
ctggctgagctcaaggaaatcatgaagaaggttgtaggaaaccgatctggctgcccaact
gtaggagacagaattgttgagctcatttacattgatattgtaggacttgctcaattcaag
aaaactcttggaccatcctgggttcattaccagtgcatgctccgagtccttgattcattt
ggtactgaacccgaatttaatcatgcaaattatgcccaatcgaaaggccacaagacccct
tggggaaaatggaatctgaaccctcagcagttttataccatgttccctcataccccagac
aacagctttctggggtttgtggttgagcagcacctgaactccagtgatatccaccacatt
aatgaaatcaaaaggcagaaccagtcccttgtgtatggcaaagtggatagcttctggaag
aataagaagatctacttggacattattcacacatacatggaagtgcatgcaactgtttat
ggctccagcacaaagaatattcccagttacgtgaaaaaccatggtatcctcagtggacgg
gacctgcagttccttcttcgagaaaccaagttgtttgttggacttgggttcccttacgag
ggcccagctcccctggaagctatcgcaaatggatgtgcttttctgaatcccaagttcaac
ccacccaaaagcagcaaaaacacagactttttcattggcaagccaactctgagagagctg
acatcccagcatccttacgctgaagttttcatcgggcggccacatgtgtggactgttgac
ctcaacaatcaggaggaagtagaggatgcagtgaaagcaattttaaatcagaagattgag
ccatacatgccatatgaatttacgtgcgaggggatgctacagagaatcaatgctttcatt
gaaaaacaggacttctgccatgggcaagtgatgtggccacccctcagcgccctacaggtc
aagcttgctgagcccgggcagtcctgcaagcaggtgtgccaggagagccagctcatctgc
gagccttctttcttccagcacctcaacaaggacaaggacatgctgaagtacaaggtgacc
tgccaaagctcagagctggccaaggacatcctggtgccctcctttgaccctaagaataag
cactgtgtgtttcaaggtgacctcctgctcttcagctgtgcaggcgcccaccccaggcac
cagagggtctgcccctgccgggacttcatcaagggccaggtggctctctgcaaagactgc
ctatag

DBGET integrated database retrieval system