KEGG   Homo sapiens (human): 4284Help
Entry
4284              CDS       T01001                                 

Gene name
MIP, AQP0, CTRCT15, LIM1, MIP26, MP26
Definition
(RefSeq) major intrinsic protein of lens fiber
  KO
K09863  aquaporin-0
Organism
hsa  Homo sapiens (human)
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4284 (MIP)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    4284 (MIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 4284
NCBI-ProteinID: NP_036196
OMIM: 154050
HGNC: 7103
Ensembl: ENSG00000135517
Vega: OTTHUMG00000170571
Pharos: P30301(Tbio)
UniProt: P30301
Position
12q13.3
AA seq 263 aa AA seqDB search
MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVG
HISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNT
LHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTG
AGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGA
KPDVSNGQPEVTGEPVELNTQAL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaactgcgatcagcctccttttggagggccatattcgctgagttctttgccacc
ctcttctatgtcttctttgggctggggtcctcactgcgctgggctcctggacccctgcat
gttctgcaggtggctatggcatttggcttggccctggctacactggtgcagtctgtgggc
cacatcagtggagcccacgtcaatcctgcagtcacttttgctttccttgtgggctcccag
atgtccctgctccgtgccttctgctatatggcagcccagctcctgggagctgtggctggg
gccgctgtgctgtatagcgttaccccacctgctgtccgaggaaacctagcactcaacacg
ttgcaccctgcggtgagcgtgggccaggcaaccacagtggagatcttcctgacgctccag
ttcgtgctctgcatctttgccacatacgacgagaggcggaatggccaactgggctccgtg
gccctggccgttggcttctcccttgccctggggcacctctttgggatgtattatactggt
gcaggcatgaatcctgcccgctcctttgctcctgccattctcactgggaacttcactaac
cactgggtgtactgggtaggcccaatcattggagggggtctgggcagcctcctgtacgac
tttcttctcttcccccggctcaagagtatttctgagagactgtctgtcctcaagggtgcc
aaacccgatgtctccaatggacaaccagaggtcacaggggaacctgttgaactgaacacc
caggccctgtag

DBGET integrated database retrieval system