KEGG   Homo sapiens (human): 445582
Entry
445582            CDS       T01001                                 
Symbol
POTEE, A26C1, A26C1A, CT104.2, POTE-2, POTE2, POTE2gamma
Name
(RefSeq) POTE ankyrin domain family member E
  KO
K17299  POTE ankyrin domain family protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    445582 (POTEE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   445582 (POTEE)
SSDB
Motif
Pfam: Actin Ank_2 Ank_5 Ank_4 Ank Ank_3 CCDC144C
Other DBs
NCBI-GeneID: 445582
NCBI-ProteinID: NP_001077007
OMIM: 608914
HGNC: 33895
Ensembl: ENSG00000188219
Vega: OTTHUMG00000186974
Pharos: Q6S8J3(Tbio)
UniProt: Q6S8J3
Position
2:131209536..131265278
AA seq 1075 aa
MVVEVDSMPAASSVKKPFGLRSKMGKWCCRCFPCYRESGKSNVGTSGDHDDSAMKTLRSK
MGKWCHHCFPCCRGSGKSNVGASGDHDDSAMKTLRNKMGKWCCHCFPCCRGSGKSKVGAW
GDYDDSAFMEPRYHVRGEDLDKLHRAAWWGKVPRKDLIVMLRDTDVNKKDKQKRTALHLA
SANGNSEVVKLLLDRRCQLNVLDNKKRTALIKAVQCQEDECALMLLEHGTDPNIPDEYGN
TTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
LDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHHVICQLLSDY
KEKQMLKISSENSNPEQELKLTSEEESQRFKGSENSQPEKMSQELEINKDGDREVEEEMK
KHESNNVGLLENLTNGVTAGNGDNGLIPQRKSRTPENQQFPDNESEEYHRICELLSDYKE
KQMPKYSSENSNPEQDLKLTSEEESQRLKGSENGQPEKRSQEPEINKDGDRELENFMAIE
EMKKHGSTHVGFPENLTNGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQ
KQFCEEQNTGILHDEILIHEEKQIEVVEKMNSELSLSCKKEKDVLHENSTLREEIAMLRL
ELDTMKHQSQLREKKYLEDIESVKKKNDNLLKALQLNELTMDDDTAVLVIDNGSGMCKAG
FAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWD
DMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVP
SLYTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPDYLMKILTERGYRF
TTMAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA
LFQPCFLGMESCGIHETTFNSIMKSDVDIRKDLYTNTVLSGGTTMYPGMAHRMQKEIAAL
APSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
NT seq 3228 nt   +upstreamnt  +downstreamnt
atggtggttgaggttgattccatgccggctgcctcttctgtgaagaagccatttggtctc
aggagcaagatgggcaagtggtgctgccgttgcttcccctgctacagggagagcggcaag
agcaacgtgggcacttctggagaccacgacgactctgctatgaagacactcaggagcaag
atgggcaagtggtgccaccactgcttcccctgctgcagggggagtggcaagagcaacgtg
ggcgcttctggagaccacgacgactctgctatgaagacactcaggaacaagatggggaag
tggtgctgccactgcttcccctgctgcagggggagcggcaagagcaaggtgggcgcttgg
ggagactacgatgacagcgccttcatggagcccaggtaccacgtccgtggagaagatctg
gacaagctccacagagctgcctggtggggtaaagtccccagaaaggatctcatcgtcatg
ctcagggacactgacgtgaacaagaaggacaagcaaaagaggactgctctacatctggcc
tctgccaatgggaattcagaagtagtaaaactcctgctggacagacgatgtcaacttaat
gtccttgacaacaaaaagaggacagctctgataaaggccgtacaatgccaggaagatgaa
tgtgcgttaatgttgctggaacatggcactgatccaaatattccagatgagtatggaaat
accactctgcactacgctatctataatgaagataaattaatggccaaagcactgctctta
tatggtgctgatatcgaatcaaaaaacaagcatggcctcacaccactgttacttggtgta
catgagcaaaaacagcaagtcgtgaaatttttaatcaagaaaaaagcgaatttaaatgca
ctggatagatatggaaggactgctctcatacttgctgtatgttgtggatcagcaagtata
gtcagccttctacttgagcaaaatattgatgtatcttctcaagatctatctggacagacg
gccagagagtatgctgtttctagtcatcatcatgtaatttgccagttactttctgactac
aaagaaaaacagatgctaaaaatctcttctgaaaacagcaatccagaacaagagttaaag
ctgacatcagaggaagagtcacaaaggttcaaaggcagtgaaaatagccagccagagaaa
atgtctcaagaactagaaataaataaggatggtgatagagaggttgaagaagaaatgaag
aagcatgaaagtaataatgtgggattactagaaaacctgactaatggtgtcactgctggc
aatggtgataatggattaattcctcaaaggaagagcagaacacctgaaaatcagcaattt
cctgacaacgaaagtgaagagtatcacagaatttgtgaattactttctgactacaaagaa
aagcagatgccaaaatactcttctgaaaacagcaacccagaacaagacttaaagctgaca
tcagaggaagagtcacaaaggcttaaaggcagtgaaaatggccagccagagaaaagatct
caagaaccagaaataaataaggatggtgatagagagctagaaaattttatggctatcgaa
gaaatgaagaagcacggaagtactcatgtcggattcccagaaaacctgactaatggtgcc
actgctggcaatggtgatgatggattaattcctccaaggaagagcagaacacctgaaagc
cagcaatttcctgacactgagaatgaagagtatcacagtgacgaacaaaatgatactcag
aagcaattttgtgaagaacagaacactggaatattacacgatgagattctgattcatgaa
gaaaagcagatagaagtggttgaaaaaatgaattctgagctttctcttagttgtaagaaa
gaaaaagacgtcttgcatgaaaatagtacgttgcgggaagaaattgccatgctaagactg
gagctagacacaatgaaacatcagagccagctaagagaaaagaaatatttggaggatatt
gaaagtgtgaaaaaaaagaatgataatcttttaaaggctctacaattgaatgagctcacc
atggatgatgataccgccgtgctcgtcattgacaacggctctggcatgtgcaaggccggc
tttgcgggcgacgatgccccccgggctgtcttcccttccatcgtggggcgccccaggcag
cagggcatgatggggggcatgcatcagaaagagtcctatgtgggcaaggaggcccagagc
aagagaggcatcctgaccctgaagtaccccatggaacacggcatcatcaccaactgggat
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggctcccgaggag
caccccatcctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtacgtggccatccaggccgtgccg
tccctgtacacctctggccgtactactggcatcgtgatggactctggtgacggggtcacc
cacactgtgcccatctatgaggggaatgccctcccccatgccaccctgcgcctagacctg
gctgggcgggaactgcctgactacctcatgaagatcctcaccgagcgtggctataggttc
accaccatggccgagcgggaaatcgtgcgtgacatcaaagagaagctgtgctatgttgcc
ctggacttcgagcaggagatggccacggcggcctccagctcctccctagagaagagctac
gagctgcccgatggccaggtcatcaccatcggcaacgagcggttccgctgccccgaggcg
ctcttccagccttgcttcctgggcatggaatcctgtggcatccatgaaactaccttcaac
tccatcatgaagtctgatgtggacatccgcaaagacctgtacaccaacacagtgctgtct
ggcggcaccaccatgtaccctggcatggcccacagaatgcagaaggagatcgctgccctg
gcgcctagcatgatgaagatcaggatcattgctcctcccaagcgcaagtactccgtgtgg
gtcggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgatgagtcaggcccctccattgtccaccgcaaatgcttctag

DBGET integrated database retrieval system