KEGG   Homo sapiens (human): 445815
Entry
445815            CDS       T01001                                 
Symbol
PALM2AKAP2, AKAP-2, AKAP-KL, AKAP2, AKAPKL, MISP2, PALM2, PALM2-AKAP2, PRKA2
Name
(RefSeq) PALM2 and AKAP2 fusion
  KO
K16519  A-kinase anchor protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    445815 (PALM2AKAP2)
SSDB
Motif
Pfam: Paralemmin AlcCBM31 Prominin Cytochrom_B562
Other DBs
NCBI-GeneID: 445815
NCBI-ProteinID: NP_001032370
OMIM: 604582
HGNC: 33529
Ensembl: ENSG00000157654
Pharos: Q9Y2D5(Tdark)
UniProt: Q8IXS6
Position
9:109640787..110172512
AA seq 379 aa
MEMAEAELHKERLQAIAEKRKRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQGIPAG
TAEEEEARRRQSEEDEFRVKQLEDNIQRLEQEIQTLESEESQISAKEQIILEKLKETEKS
FKDFQKGFSSTDGAVYAMEINVEKDKQTGETKILSTSTIGPEGVHQKGVKVYDDGTKVVY
EVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKE
AKLEMVHKSRKDHSSGNPGQQAQAPSAAGPEANLDQPVTMIFMGYQNIEDEEETKKVLGY
DETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLA
TEPAPGTQKKKRCQCCVVM
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggagatggcagaggcggaattgcacaaggaaaggctgcaagccatagcagaaaaaaga
aagaggcagactgaaatagaaggcaagcgacaacagcttgacgagcagatacttctgctg
cagcattccaagtccaaagtgcttcgggagaaatggctgctgcagggcatacccgctgga
actgccgaagaggaggaagccaggaggcggcagtctgaagaggatgagttcagagtcaag
caacttgaagataacattcagaggctggagcaagaaatacaaacgctagaaagtgaagag
tcccagatatctgccaaagagcaaatcatcctagagaaactgaaggaaacagaaaaatcc
ttcaaggactttcagaagggtttctccagtacggatggagctgtgtacgccatggaaatt
aatgtggagaaagacaaacaaacaggagagaccaagattctctctacatctaccattggc
ccagagggggtccatcagaaaggagtcaaagtctatgatgatggtaccaaagtagtgtat
gaggtgcgctcaggaggcaccgtagtagaaaatggagtgcacaaattaagcacaaaggat
gtagaagagcttattcagaaggctggacaatcaagcttaggaggagggcacgtgtctgaa
aggactgtgattgcagatgggagcctcagccatcccaaggaacacatgctctgcaaagaa
gctaagttagaaatggtacataagtctaggaaagaccattcttccgggaacccagggcag
caggcccaagcccccagcgctgcagggccggaggcaaacttggatcagcccgtcaccatg
atttttatgggctaccaaaatatcgaggatgaagaggagacgaaaaaggtgctaggctat
gatgaaaccatcaaggctgaattggtcctcattgatgaagatgatgagaagtcattgagg
gagaagacagtgacggacgtgtccactattgacgggaacgcggctgagcttgtgtccggg
aggccggtctcagacaccacagagccctcatccccagaagggaaggaagagagcctagct
acagagccagccccaggtacccaaaagaaaaagcgctgtcaatgctgtgttgtcatgtga

DBGET integrated database retrieval system