KEGG   Homo sapiens (human): 4645Help
Entry
4645              CDS       T01001                                 

Gene name
MYO5B
Definition
(RefSeq) myosin VB
  KO
K10357  myosin V
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
Disease
H01174  Congenital diarrhea
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4645 (MYO5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4645 (MYO5B)
   04131 Membrane trafficking [BR:hsa04131]
    4645 (MYO5B)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4645 (MYO5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4645 (MYO5B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Cargo complex
     4645 (MYO5B)
   mRNA cycle factors
    P-body specific factors
     4645 (MYO5B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Myosins
    4645 (MYO5B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    4645 (MYO5B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4645 (MYO5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head DIL IQ Myosin_N AAA_22 AAA_16 Tmemb_161AB
Motif
Other DBs
NCBI-GeneID: 4645
NCBI-ProteinID: NP_001073936
OMIM: 606540
HGNC: 7603
Ensembl: ENSG00000167306
Vega: OTTHUMG00000179843
Pharos: Q9ULV0(Tbio)
UniProt: Q9ULV0 Q7Z7A5
Structure
PDB: 

Position
18q21.1
AA seq 1848 aa AA seqDB search
MSVGELYSQCTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDETILEYPIDVQRNQLP
FLRNPDILVGENDLTALSYLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYG
QDVIYTYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYF
ATVGGSASETNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFDKRYHIIGANMR
TYLLEKSRVVFQADDERNYHIFYQLCAAAGLPEFKELALTSAEDFFYTSQGGDTSIEGVD
DAEDFEKTRQAFTLLGVKESHQMSIFKIIASILHLGSVAIQAERDGDSCSISPQDVYLSN
FCRLLGVEHSQMEHWLCHRKLVTTSETYVKTMSLQQVINARNALAKHIYAQLFGWIVEHI
NKALHTSLKQHSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNSHVFKLEQEEYMK
EQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYDRHSSSQHFQK
PRMSNTAFIIVHFADKVEYLSDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDPVP
ATTPGKGSSSKISVRSARPPMKVSNKEHKKTVGHQFRTSLHLLMETLNATTPHYVRCIKP
NDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWAYHDFFNRYRVLVKKRELANTD
KKAICRSVLENLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFRTATIMIQKTVRGWLQ
KVKYHRLKGATLTLQRYCRGHLARRLAEHLRRIRAAVVLQKHYRMQRARQAYQRVRRAAV
VIQAFTRAMFVRRTYRQVLMEHKATTIQKHVRGWMARRHFQRLRDAAIVIQCAFRMLKAR
RELKALRIEARSAEHLKRLNVGMENKVVQLQRKIDEQNKEFKTLSEQLSVTTSTYTMEVE
RLKKELVHYQQSPGEDTSLRLQEEVESLRTELQRAHSERKILEDAHSREKDELRKRVADL
EQENALLKDEKEQLNNQILCQSKDEFAQNSVKENLMKKELEEERSRYQNLVKEYSQLEQR
YDNLRDEMTIIKQTPGHRRNPSNQSSLESDSNYPSISTSEIGDTEDALQQVEEIGLEKAA
MDMTVFLKLQKRVRELEQERKKLQVQLEKREQQDSKKVQAEPPQTDIDLDPNADLAYNSL
KRQELESENKKLKNDLNELRKAVADQATQNNSSHGSPDSYSLLLNQLKLAHEELEVRKEE
VLILRTQIVSADQRRLAGRNAEPNINARSSWPNSEKHVDQEDAIEAYHGVCQTNSKTEDW
GYLNEDGELGLAYQGLKQVARLLEAQLQAQSLEHEEEVEHLKAQLEALKEEMDKQQQTFC
QTLLLSPEAQVEFGVQQEISRLTNENLDLKELVEKLEKNERKLKKQLKIYMKKAQDLEAA
QALAQSERKRHELNRQVTVQRKEKDFQGMLEYHKEDEALLIRNLVTDLKPQMLSGTVPCL
PAYILYMCIRHADYTNDDLKVHSLLTSTINGIKKVLKKHNDDFEMTSFWLSNTCRLLHCL
KQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIKIAEGVLQPMIVSA
MLENESIQGLSGVKPTGYRKRSSSMADGDNSYCLEAIIRQMNAFHTVMCDQGLDPEIILQ
VFKQLFYMINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGRNLHQSGAVQTMEPL
IQAAQLLQLKKKTQEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVAFIRTIQAQ
LQERNDPQQLLLDAKHMFPVLFPFNPSSLTMDSIHIPACLNLEFLNEV
NT seq 5547 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgggcgagctctacagccagtgcacaagggtctggatccctgaccctgatgag
gtatggcgctcagctgagttaaccaaggactacaaagaaggagacaagagcctacagctc
agactggaggatgaaacgattctggaatacccaattgatgtacaacgcaaccagctgccc
ttcttacggaatccagatatcttggtgggagaaaatgacctgactgcccttagctatctt
catgagcctgcagttttgcataatttgaaggtccgtttcctggagtccaaccatatctac
acttactgtggtatcgtacttgttgccattaatccttatgaacagttgccaatctatgga
caagatgtcatctatacctacagtggccaaaacatgggagacatggacccccacatcttt
gctgtggcagaagaagcctacaagcagatggccagagatgagaagaatcagtccatcata
gtcagtggggagtctggagccgggaagacggtatcagccaagtatgccatgcgctatttc
gccaccgttggtggctcggccagtgaaaccaacatcgaagagaaggtgctggcatccagt
cccatcatggaggccattggaaatgccaagaccacccgcaatgacaacagcagccgtttt
ggcaagtacatccagattggctttgacaaaaggtaccacatcatcggggccaacatgagg
acttacctcttggagaagtccagagtggtcttccaggcagatgatgagaggaattaccac
atcttttaccagctctgtgctgctgccggtcttccagaatttaaagagcttgcactaaca
agtgcagaggactttttctatacatcacagggaggagacacttccatcgagggtgtggac
gatgctgaggactttgagaagactcgacaagccttcacactcctcggagtgaaagagtcc
catcagatgagcatttttaagataattgcttctatcttgcaccttggaagtgtggcgatt
caggctgagcgtgatggtgattcctgtagtatatcaccccaggatgtatacctaagcaac
ttctgccgactgctaggggtggagcacagtcagatggagcactggctgtgtcatcgcaag
ctggtcaccacctcggagacctacgtcaagaccatgtccctgcagcaggtgatcaatgcg
cgcaacgccctggcgaagcacatctatgcccagttgttcggctggattgtggagcacatc
aacaaggccctgcacacctccctcaagcagcactccttcatcggggtcctggacatctat
gggtttgagacatttgaggtaaacagctttgagcagttctgtatcaactatgcaaatgaa
aagctccagcagcagttcaactcgcatgttttcaaactggagcaagaagaatacatgaag
gaacagatcccttggaccctgattgatttttatgataaccaaccttgtatcgacctcatt
gaagccaagctgggtatcttggacctgttggatgaagaatgtaaggtccccaaaggaact
gaccagaactgggctcagaagctctatgaccggcactccagcagccagcacttccagaag
ccccgcatgtccaacacggccttcatcatcgtccactttgcagacaaggtggagtacctc
tctgatggttttctggagaaaaacagagacacggtgtatgaagagcagatcaatatcctg
aaggccagcaagttcccactagtggctgacttgtttcatgatgacaaggaccctgttcct
gccaccacccctgggaaggggtcatcttcgaagatcagcgtccgttctgccagacccccc
atgaaagtctccaacaaggagcacaagaaaaccgttggccaccagttccgtacctccctg
catctgctcatggagaccctgaatgccacgacacctcactatgtccgctgcatcaagccc
aacgatgagaagctcccctttcactttgacccaaagagagcagtgcagcaactcagagcc
tgcggggtgttggagacgattcgaatcagtgcagctggctacccatccaggtgggcctac
catgactttttcaaccggtatcgggtgctggtcaagaagagagagctcgccaacacagac
aaaaaggccatctgcaggtctgtcctggagaacctcatcaaggaccccgacaagttccag
tttggccgcaccaagatcttctttcgagcaggccaggtggcctacctggagaagctgcgg
gctgacaagttccggacagccaccatcatgatccagaaaactgtccggggatggctgcag
aaggtgaaatatcacaggctgaagggggctaccttaaccctgcagaggtactgccgggga
cacctggcccgcaggctggctgagcacctgcggaggatcagagcggctgtggtgctccag
aaacattaccgcatgcagagggcccgccaggcctaccagagggtccgcagagctgccgtt
gttatccaggccttcacccgggccatgtttgtgcggagaacctaccgccaggtcctcatg
gagcacaaggccaccaccatccagaagcacgtgcggggctggatggcacgcaggcacttc
cagcggctgcgggatgcagccattgtcatccagtgtgccttccggatgctcaaggccagg
cgggagctgaaggccctcaggattgaggcccgctcagcagagcatctgaaacgtctcaac
gtgggcatggagaacaaggtggtccagctgcagcggaagatcgatgagcagaacaaagag
ttcaagacactttcagagcagttgtccgtgaccacctcaacatacaccatggaggtagag
cggctgaagaaggagctggtgcactaccagcagagcccaggtgaggacaccagcctcagg
ctgcaggaggaggtggagagcctgcgcacagagctgcagagggcccactcggagcgcaag
atcttggaggacgcccacagcagggagaaagatgagctgaggaagcgagttgcagacctg
gagcaagaaaatgctctcttgaaagatgagaaagaacagctcaacaaccaaatcctgtgc
cagtctaaagatgaatttgcccagaactctgtgaaggaaaatctcatgaagaaagaactg
gaggaggagcgatcccggtaccagaaccttgtgaaggaatattcacagttggagcagaga
tacgacaaccttcgggatgaaatgaccatcataaagcaaactccaggtcataggcggaac
ccatcaaaccaaagtagcttagaatctgactccaattacccctccatctccacatctgag
atcggagacactgaggatgccctccagcaggtggaggaaattggcctggagaaggcagcc
atggacatgacggtcttcctgaagctgcagaagagagtacgggagctggagcaggagagg
aaaaagctgcaagtgcagctggagaagagagaacagcaggacagcaagaaagtccaggcg
gaaccaccacagactgacatagatttggacccgaatgcagatctggcctacaatagtctg
aagaggcaagagctggagtcagagaacaaaaagctgaagaatgacctgaatgagctgagg
aaagccgtggccgaccaagccacgcagaataactccagccacggctccccagatagctac
agcctcctgctgaaccagctcaagctggcccacgaggagctcgaggtgcgcaaggaggag
gtgctcatcctcaggacccagatcgtgagcgccgaccagcggcgactcgccggcaggaac
gcggagccgaacattaatgccagatcaagttggcctaacagtgaaaagcatgttgaccag
gaggatgccattgaggcctatcacggggtctgccagacaaacagcaagactgaggattgg
ggatatttaaatgaagatggagaactcggcttggcctaccaaggcctaaagcaagttgcc
aggctgctggaggctcagctgcaggcccagagcctggagcatgaggaggaggtggagcat
ctcaaggctcagctcgaggccctgaaggaggagatggacaaacagcagcagaccttctgc
cagacgctactgctctccccagaggcccaggtggaattcggcgttcagcaggaaatatcc
cggctgaccaacgagaatctggaccttaaagaactggtagaaaagctggaaaagaatgag
aggaagctcaaaaagcaactgaagatttacatgaagaaagcccaggacctagaagctgcc
caggcattggcccagagtgagaggaagcgccatgagctcaacaggcaggtcacggtccag
cggaaagagaaggatttccagggcatgctggagtaccacaaagaggacgaggccctcctc
atccggaacctggtgacagacttgaagccccagatgctgtcgggcacagtgccctgtctc
cccgcctacatcctctacatgtgcatccggcacgcggactacaccaacgacgatctcaag
gtgcactccctgctgacctccaccatcaacggcattaagaaagtcctgaaaaagcacaat
gatgactttgagatgacgtcattctggttatccaacacctgccgccttcttcactgtctg
aagcagtacagcggggatgagggcttcatgactcagaacactgcaaagcagaatgaacac
tgtcttaagaattttgacctcaccgaataccgtcaggtgctgagtgacctttccattcag
atctaccagcagctcattaaaattgccgagggcgtgttacagccgatgatagtttctgcc
atgttggaaaatgagagcattcagggtctatctggtgtgaagcccaccggctaccggaag
cgctcctccagcatggcagatggggataactcatactgcctggaagctatcatccgccag
atgaatgcctttcatacagtcatgtgtgaccagggcttggaccctgagatcatcctgcag
gtattcaaacagctcttctacatgatcaacgcagtgactcttaacaacctgctcttgcgg
aaggacgtctgctcttggagcacaggcatgcaactcaggtacaatataagtcagcttgag
gagtggcttcggggaagaaaccttcaccagagtggagcagttcagaccatggaacctctg
atccaagcagcccagctcctgcaattaaagaagaaaacccaggaggacgcagaggctatc
tgctccctgtgtacctccctcagcacccagcagattgtcaaaattttaaacctttatact
cccctgaatgaatttgaagaacgggtaacagtggcctttatacgaacaatccaggcacaa
ctacaagagcggaatgaccctcagcaactgctattagatgccaagcacatgtttcctgtt
ttgtttccatttaatccatcttctctaaccatggactcaatccacatcccagcgtgtctc
aatctggaattcctcaatgaagtctga

DBGET integrated database retrieval system