KEGG   Homo sapiens (human): 4725
Entry
4725              CDS       T01001                                 
Symbol
NDUFS5, CI-15k, CI15K
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit S5
  KO
K03938  NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4725 (NDUFS5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4725 (NDUFS5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4725 (NDUFS5)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4725 (NDUFS5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4725 (NDUFS5)
   05012 Parkinson disease
    4725 (NDUFS5)
   05014 Amyotrophic lateral sclerosis
    4725 (NDUFS5)
   05016 Huntington disease
    4725 (NDUFS5)
   05020 Prion disease
    4725 (NDUFS5)
   05022 Pathways of neurodegeneration - multiple diseases
    4725 (NDUFS5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4725 (NDUFS5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4725 (NDUFS5)
SSDB
Motif
Pfam: Ndufs5 Cmc1
Other DBs
NCBI-GeneID: 4725
NCBI-ProteinID: NP_001171908
OMIM: 603847
HGNC: 7712
Ensembl: ENSG00000168653
Pharos: O43920(Tclin)
UniProt: O43920 Q6IBA0
Structure
Position
1:39026350..39034615
AA seq 106 aa
MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY
DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
NT seq 321 nt   +upstreamnt  +downstreamnt
atgcctttcttggacatccagaaaaggttcggccttaacatagatcgatggttgacaatc
cagagtggtgaacagccctacaagatggctggtcgatgccatgcttttgaaaaagaatgg
atagaatgtgcacatggaatcggttatactcgggcagagaaagagtgcaagatagaatat
gatgatttcgtagagtgtttgcttcggcagaaaacgatgagacgtgcaggtaccatcagg
aagcagcgggataagctgataaaggaaggaaagtacacccctccacctcaccacattggc
aagggggagcctcggccctga

DBGET integrated database retrieval system