KEGG   Homo sapiens (human): 4904Help
Entry
4904              CDS       T01001                                 

Gene name
YBX1, BP-8, CBF-A, CSDA2, CSDB, DBPB, EFI-A, MDR-NF1, NSEP-1, NSEP1, YB-1, YB1
Definition
(RefSeq) Y-box binding protein 1
  KO
K09276  Y-box-binding protein 1
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Cold-shock domain factors, YB-1/DbpB-like
    4904 (YBX1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Other mRNA localization factors
     4904 (YBX1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4904 (YBX1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   General mRNP proteins
    4904 (YBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-GeneID: 4904
NCBI-ProteinID: NP_004550
OMIM: 154030
HGNC: 8014
Ensembl: ENSG00000065978
Vega: OTTHUMG00000007523
Pharos: P67809(Tbio)
UniProt: P67809
Structure
PDB: 

Position
1p34.2
AA seq 324 aa AA seqDB search
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVL
GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGA
EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEG
QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRG
YRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaggccgagacccagcagccgcccgccgccccccccgccgcccccgccctc
agcgccgccgacaccaagcccggcactacgggcagcggcgcagggagcggtggcccgggc
ggcctcacatcggcggcgcctgccggcggggacaagaaggtcatcgcaacgaaggttttg
ggaacagtaaaatggttcaatgtaaggaacggatatggtttcatcaacaggaatgacacc
aaggaagatgtatttgtacaccagactgccataaagaagaataaccccaggaagtacctt
cgcagtgtaggagatggagagactgtggagtttgatgttgttgaaggagaaaagggtgcg
gaggcagcaaatgttacaggtcctggtggtgttccagttcaaggcagtaaatatgcagca
gaccgtaaccattatagacgctatccacgtcgtaggggtcctccacgcaattaccagcaa
aattaccagaatagtgagagtggggaaaagaacgagggatcggagagtgctcccgaaggc
caggcccaacaacgccggccctaccgcaggcgaaggttcccaccttactacatgcggaga
ccctatgggcgtcgaccacagtattccaaccctcctgtgcagggagaagtgatggagggt
gctgacaaccagggtgcaggagaacaaggtagaccagtgaggcagaatatgtatcgggga
tatagaccacgattccgcaggggccctcctcgccaaagacagcctagagaggacggcaat
gaagaagataaagaaaatcaaggagatgagacccaaggtcagcagccacctcaacgtcgg
taccgccgcaacttcaattaccgacgcagacgcccagaaaaccctaaaccacaagatggc
aaagagacaaaagcagccgatccaccagctgagaattcgtccgctcccgaggctgagcag
ggcggggctgagtaa

DBGET integrated database retrieval system