KEGG   Homo sapiens (human): 4931
Entry
4931              CDS       T01001                                 
Symbol
NVL, NVL2
Name
(RefSeq) nuclear VCP like
  KO
K14571  ribosome biogenesis ATPase
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4931 (NVL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    4931 (NVL)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    4931 (NVL)
SSDB
Motif
Pfam: AAA Nucleolin_bd AAA_lid_3 RuvB_N AAA_16 AAA_2 AAA_22 AAA_5 AAA_33 TIP49 AAA_14 Mg_chelatase Zeta_toxin AAA_18 RNA_helicase AAA_28 NACHT ATPase ABC_tran TsaE IstB_IS21 AAA_3 Viral_helicase1 Rad17 Cytidylate_kin2 AAA_17 Sigma54_activat Vps4_C Sigma54_activ_2 DUF815 Tnp_22_trimer
Other DBs
NCBI-GeneID: 4931
NCBI-ProteinID: NP_002524
OMIM: 602426
HGNC: 8070
Ensembl: ENSG00000143748
Pharos: O15381(Tbio)
UniProt: O15381 B4DF43
Structure
Position
1:complement(224227345..224330172)
AA seq 856 aa
MKPRPAGFVDNKLKQRVIQYLTSNKCGKYVDIGVLASDLQRVYSIDYGRRKRNAFRIQVE
KVFSIISSEKELKNLTELEDEHLAKRARQGEEDNEYTESYSDDDSSMEDYPDPQSANHMN
SSLLSLYRKGNPDSVSNTPEMEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFIDKTPS
VKKDSFFLDLSCEKSNPKKPITEIQDSKDSSLLESDMKRKGKLKNKGSKRKKEDLQEVDG
EIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRG
VLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCI
IFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPAL
RRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCRE
AAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDP
LSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAP
VRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESE
RAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFI
MAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIA
GDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSIS
KKDQIMYERLQESLSR
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgaagcccagacctgcagggttcgtggataataaactcaagcagcgagtcatccagtac
cttaccagtaacaaatgtggcaaatatgtggacattggagtcttagcgtctgatttacaa
agagtgtacagtatagactatggtcgaagaaaaagaaatgcttttaggattcaggtagaa
aaagtatttagcataattagtagtgagaaggaacttaagaatttaacagaattagaagat
gaacatttggcaaaaagggcaagacaaggtgaagaggataatgagtatactgaaagctat
tctgatgatgattcaagtatggaagactacccagatccacagtcagcaaatcacatgaac
agttccctgctgtctttatatcggaaaggaaatcctgattctgtttcaaatactcctgag
atggagcaaagagaaaccacctcttcaacaccacggataagttccaaaacaggctccatt
cccttgaagacccctgccaaagattctgaaggaggatggtttattgacaaaaccccaagt
gtaaagaaagacagttttttcttggacctgtcatgtgagaaaagtaatcctaagaagcca
ataactgagatacaggattcaaaagattcttctcttttggagagtgatatgaaacggaaa
ggcaagctaaagaataaaggaagcaaaaggaagaaagaagatcttcaggaagtagatgga
gaaattgaagctgtcctgcaaaagaaagctaaagccagggggttagaattccagatctcc
aacgtgaagtttgaagatgtgggaggcaatgatatgacattaaaagaggtctgcaagatg
ctcatacacatgcgtcacccggaggtgtaccaccacctgggcgtcgtgccccctcgtgga
gttctccttcatggaccaccaggctgtgggaagacattacttgcacatgcaattgctggg
gaacttgacctgccaattttgaaagtggctgctccagagattgtgtctggagtatccgga
gagtctgagcagaagctgagagaactatttgagcaagctgtgtcaaatgcaccatgtatc
attttcattgatgaaattgatgctattacccccaaaagagaagtggcttcaaaagatatg
gaacgaagaattgtagcccaactcctaacctgcatggatgatctgaataatgtggctgct
acagcccgggtcctagttattggagctactaatcgaccagactcgttagaccctgctttg
agacgtgcgggaaggttcgaccgagaaatatgcctaggtatcccagatgaagcatccagg
gaaagaatacttcaaacattgtgcagaaaactgaggcttcctcaagcttttgatttctgt
cacttagcacacctaactccaggctttgttggtgctgatctcatggcactgtgccgagag
gcagcaatgtgtgcagtcaatagagtcttaatgaagctacaggaacagcagaagaaaaat
cctgaaatggaagatttgccatctaaaggagtccaggaggaaaggctgggaactgagccc
acttctgaaacacaggatgaattacaaaggctgctggggttgctaagagaccaagatccc
ctctcagaggagcagatgcaaggactgtgcattgaactgaatgatttcattgttgctcta
tcctcagtccaaccctctgccaaaagggaaggctttgtcactgtccctaatgtgacatgg
gcagatattggtgccctggaagacattagagaggagctcaccatggcaatattggcacca
gtacgcaacccagaccagttcaaagctcttggattggtgactccagctggggtcctcctt
gctggtcctcctggctgtgggaagactctgctggcgaaggctgttgcaaatgagtccgga
ctaaattttatatctgtcaagggccccgaattactaaacatgtatgttggtgagagtgaa
cgtgctgtgcgacaagtttttcaacgagccaagaactcagcaccctgtgtgatattcttt
gatgaagtggatgctttatgtcctcgaagatcagaccgagagacaggggcaagtgtccga
gtggtgaatcagctacttacagagatggatggtctggaagcacgccagcaggtttttatt
atggcagccactaacaggccagatataattgaccctgcaatcctgcgcccgggccgcctg
gacaaaacactgtttgtgggtttaccgccccctgcagatcgccttgccatcttaaaaact
atcacaaaaaatggtaccaaaccaccactggatgcagatgtaaatttggaagcaattgct
ggtgaccttcgctgtgattgctatacgggcgcagatctctctgctttggtacgagaagct
tctatctgtgccctgagacaggaaatggcaagacagaagagtggaaatgaaaaaggtgaa
ctcaaggttagtcataagcattttgaagaagctttcaagaaagtaagatcatctatatca
aaaaaggatcaaatcatgtatgaacgtttgcaggagtccctcagccggtga

DBGET integrated database retrieval system