KEGG   Homo sapiens (human): 5015Help
Entry
5015              CDS       T01001                                 

Gene name
OTX2, CPHD6, MCOPS5
Definition
(RefSeq) orthodenticle homeobox 2
  KO
K18490  homeobox protein OTX2
Organism
hsa  Homo sapiens (human)
Disease
H00254  Growth hormone deficiency
H00544  Septo-optic dysplasia
H01027  Anophthalmia and microphthalmia (A/M)
H01667  Medulloblastoma
H02036  Combined pituitary hormone deficiency
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    5015 (OTX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TF_Otx Homeobox NUDE_C SatD
Motif
Other DBs
NCBI-GeneID: 5015
NCBI-ProteinID: NP_001257452
OMIM: 600037
HGNC: 8522
Ensembl: ENSG00000165588
Vega: OTTHUMG00000152338
Pharos: P32243(Tbio)
UniProt: P32243 F1T0D1
Position
14q22.3
AA seq 289 aa AA seqDB search
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKT
RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPARE
VSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYT
QASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLST
QGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcttatcttaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcg
ggtatggacttgctgcacccctccgtgggctacccggccaccccccggaaacagcgccgg
gagaggacgacgttcactcgggcgcagctagatgtgctggaagcactgtttgccaagacc
cggtacccagacatcttcatgcgagaggaggtggcactgaaaatcaacttgcccgagtcg
agggtgcaggtatggtttaagaatcgaagagctaagtgccgccaacaacagcaacaacag
cagaatggaggtcaaaacaaagtgagacctgccaaaaagaagacatctccagctcgggaa
gtgagttcagagagtggaacaagtggccaattcactcccccctctagcacctcagtcccg
accattgccagcagcagtgctcctgtgtctatctggagcccagcttccatctccccactg
tcagatcccttgtccacctcctcttcctgcatgcagaggtcctatcccatgacctatact
caggcttcaggttatagtcaaggatatgctggctcaacttcctactttgggggcatggac
tgtggatcatatttgacccctatgcatcaccagcttcccggaccaggggccacactcagt
cccatgggtaccaatgcagtcaccagccatctcaatcagtccccagcttctctttccacc
cagggatatggagcttcaagcttgggttttaactcaaccactgattgcttggattataag
gaccaaactgcctcctggaagcttaacttcaatgctgactgcttggattataaagatcag
acatcctcgtggaaattccaggttttgtga

DBGET integrated database retrieval system