KEGG   Homo sapiens (human): 50861
Entry
50861             CDS       T01001                                 
Symbol
STMN3, SCLIP
Name
(RefSeq) stathmin 3
  KO
K26158  stathmin 2/3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    50861 (STMN3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Stathmin
     50861 (STMN3)
SSDB
Motif
Pfam: Stathmin Exonuc_VII_L DUF2408
Other DBs
NCBI-GeneID: 50861
NCBI-ProteinID: NP_056978
OMIM: 608362
HGNC: 15926
Ensembl: ENSG00000197457
UniProt: Q9NZ72
Position
20:complement(63639712..63653424)
AA seq 180 aa
MASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKS
PSDLSPESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHK
ALEENNNFSRQAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
NT seq 543 nt   +upstreamnt  +downstreamnt
atggccagcaccatttccgcctacaaggagaagatgaaggagctgtcggtgctgtcgctc
atctgctcctgcttctacacacagccgcaccccaataccgtctaccagtacggggacatg
gaggtgaagcagctggacaagcgggcctcaggccagagcttcgaggtcatcctcaagtcc
ccttctgacctgtccccagagagccctatgctctcctccccacccaagaagaaggacacc
tccctggaggagctgcaaaagcggctggaggcagccgaggagcggaggaagacgcaggag
gcgcaggtgctgaagcagctggcggagcggcgcgagcacgagcgcgaggtgctgcacaag
gcgctggaggagaataacaacttcagccgccaggcggaggagaagctcaactacaagatg
gagctcagcaaggagatccgcgaggcacacctggccgcactgcgcgagcggctgcgcgag
aaggagctgcacgcggccgaggtgcgcaggaacaaggagcagcgagaagagatgtcgggc
taa

DBGET integrated database retrieval system