KEGG   Homo sapiens (human): 50964Help
Entry
50964             CDS       T01001                                 

Gene name
SOST, CDD, DAND6, SOST1, VBCH
Definition
(RefSeq) sclerostin
  KO
K16834  sclerostin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Disease
H00486  Sclerosteosis
H01774  Hyperostosis corticalis generalisata
Drug target
Blosozumab: D10094
Romosozumab: D10156
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    50964 (SOST)
 Organismal Systems
  Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    50964 (SOST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sclerostin DAN Cys_knot
Motif
Other DBs
NCBI-GeneID: 50964
NCBI-ProteinID: NP_079513
OMIM: 605740
HGNC: 13771
Ensembl: ENSG00000167941
Vega: OTTHUMG00000180888
Pharos: Q9BQB4(Tbio)
UniProt: Q9BQB4
Structure
PDB: 

Position
17q21.31
AA seq 213 aa AA seqDB search
MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAE
NGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIG
RGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELK
DFGTEAARPQKGRKPRPRARSAKANQAELENAY
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcccactggccctgtgtctcgtctgcctgctggtacacacagccttccgtgta
gtggagggccaggggtggcaggcgttcaagaatgatgccacggaaatcatccccgagctc
ggagagtaccccgagcctccaccggagctggagaacaacaagaccatgaaccgggcggag
aacggagggcggcctccccaccacccctttgagaccaaagacgtgtccgagtacagctgc
cgcgagctgcacttcacccgctacgtgaccgatgggccgtgccgcagcgccaagccggtc
accgagctggtgtgctccggccagtgcggcccggcgcgcctgctgcccaacgccatcggc
cgcggcaagtggtggcgacctagtgggcccgacttccgctgcatccccgaccgctaccgc
gcgcagcgcgtgcagctgctgtgtcccggtggtgaggcgccgcgcgcgcgcaaggtgcgc
ctggtggcctcgtgcaagtgcaagcgcctcacccgcttccacaaccagtcggagctcaag
gacttcgggaccgaggccgctcggccgcagaagggccggaagccgcggccccgcgcccgg
agcgccaaagccaaccaggccgagctggagaacgcctactag

DBGET integrated database retrieval system