KEGG   Homo sapiens (human): 5106Help
Entry
5106              CDS       T01001                                 

Gene name
PCK2, PEPCK, PEPCK-M, PEPCK2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase 2, mitochondrial
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04964  Proximal tubule bicarbonate reclamation
Module
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5106 (PCK2)
   00020 Citrate cycle (TCA cycle)
    5106 (PCK2)
   00620 Pyruvate metabolism
    5106 (PCK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    5106 (PCK2)
   04151 PI3K-Akt signaling pathway
    5106 (PCK2)
   04152 AMPK signaling pathway
    5106 (PCK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5106 (PCK2)
   04922 Glucagon signaling pathway
    5106 (PCK2)
   04920 Adipocytokine signaling pathway
    5106 (PCK2)
   03320 PPAR signaling pathway
    5106 (PCK2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    5106 (PCK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    5106 (PCK2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     5106 (PCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_GTP PEPCK_N
Motif
Other DBs
NCBI-GeneID: 5106
NCBI-ProteinID: NP_004554
OMIM: 614095
HGNC: 8725
Ensembl: ENSG00000100889
Vega: OTTHUMG00000028791
Pharos: Q16822(Tbio)
UniProt: Q16822 A0A384MTT2
Position
14q11.2-q12
AA seq 640 aa AA seqDB search
MAALYRPGLRLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGI
HICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHV
PDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAA
AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSAT
TNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKEPCAHP
NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRS
ESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEA
GHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPK
DFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggccgcattgtaccgccctggcctgcggcttaactggcatgggctgagccccttgggc
tggccatcatgccgtagcatccagaccctgcgagtgcttagtggagatctgggccagctt
cccactggcattcgagattttgtagagcacagtgcccgcctgtgccaaccagagggcatc
cacatctgtgatggaactgaggctgagaatactgccacactgaccctgctggagcagcag
ggcctcatccgaaagctccccaagtacaataactgctggctggcccgcacagaccccaag
gatgtggcacgagtagagagcaagacggtgattgtaactccttctcagcgggacacggta
ccactcccgcctggtggggcccgtgggcagctgggcaactggatgtccccagctgatttc
cagcgagctgtggatgagaggtttccaggctgcatgcagggccgcaccatgtatgtgctt
ccattcagcatgggtcctgtgggctccccgctgtcccgcatcggggtgcagctcactgac
tcagcctatgtggtggcaagcatgcgtattatgacccgactggggacacctgtgcttcag
gccctgggagatggtgactttgtcaagtgtctgcactccgtgggccagcccctgacagga
caaggggagccagtgagccagtggccgtgcaacccagagaaaaccctgattggccacgtg
cccgaccagcgggagatcatctccttcggcagcggctatggtggcaactccctgctgggc
aagaagtgctttgccctacgcatcgcctctcggctggcccgggatgagggctggctggca
gagcacatgctgatcctgggcatcaccagccctgcagggaagaagcgctatgtggcagcc
gccttccctagtgcctgtggcaagaccaacctggctatgatgcggcctgcactgccaggc
tggaaagtggagtgtgtgggggatgatattgcttggatgaggtttgacagtgaaggtcga
ctccgggccatcaaccctgagaacggcttctttggggttgcccctggtacctctgccacc
accaatcccaacgccatggctacaatccagagtaacactatttttaccaatgtggctgag
accagtgatggtggcgtgtactgggagggcattgaccagcctcttccacctggtgttact
gtgacctcctggctgggcaaaccctggaaacctggtgacaaggagccctgtgcacatccc
aactctcgattttgtgccccggctcgccagtgccccatcatggacccagcctgggaggcc
ccagagggtgtccccattgacgccatcatctttggtggccgcagacccaaaggggtaccc
ctggtatacgaggccttcaactggcgtcatggggtgtttgtgggcagcgccatgcgctct
gagtccactgctgcagcagaacacaaagggaagatcatcatgcacgacccatttgccatg
cggcccttttttggctacaacttcgggcactacctggaacactggctgagcatggaaggg
cgcaagggggcccagctgccccgtatcttccatgtcaactggttccggcgtgacgaggca
gggcacttcctgtggccaggctttggggagaatgctcgggtgctagactggatctgccgg
cggttagagggggaggacagtgcccgagagacacccattgggctggtgccaaaggaagga
gccttggatctcagcggcctcagagctatagacaccactcagctgttctccctccccaag
gacttctgggaacaggaggttcgtgacattcggagctacctgacagagcaggtcaaccag
gatctgcccaaagaggtgttggctgagcttgaggccctggagagacgtgtgcacaaaatg
tga

DBGET integrated database retrieval system