KEGG   Homo sapiens (human): 513
Entry
513               CDS       T01001                                 
Symbol
ATP5F1D, ATP5D, MC5DN5
Name
(RefSeq) ATP synthase F1 subunit delta
  KO
K02134  F-type H+-transporting ATPase subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    513 (ATP5F1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    513 (ATP5F1D)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    513 (ATP5F1D)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    513 (ATP5F1D)
   05012 Parkinson disease
    513 (ATP5F1D)
   05014 Amyotrophic lateral sclerosis
    513 (ATP5F1D)
   05016 Huntington disease
    513 (ATP5F1D)
   05020 Prion disease
    513 (ATP5F1D)
   05022 Pathways of neurodegeneration - multiple diseases
    513 (ATP5F1D)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    513 (ATP5F1D)
SSDB
Motif
Pfam: ATP-synt_DE_N
Other DBs
NCBI-GeneID: 513
NCBI-ProteinID: NP_001001975
OMIM: 603150
HGNC: 837
Ensembl: ENSG00000099624
Pharos: P30049(Tdark)
UniProt: P30049
Position
19:1241751..1244825
AA seq 168 aa
MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDV
PTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAV
TLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgctgcccgccgcgctgctccgccgcccgggacttggccgcctcgtccgccacgcccgt
gcctatgccgaggccgccgccgccccggctgccgcctctggccccaaccagatgtccttc
accttcgcctctcccacgcaggtgttcttcaacggtgccaacgtccggcaggtggacgtg
cccacgctgaccggagccttcggcatcctggcggcccacgtgcccacgctgcaggtcctg
cggccggggctggtcgtggtgcatgcagaggacggcaccacctccaaatactttgtgagc
agcggttccatcgcagtgaacgccgactcttcggtgcagttgttggccgaagaggccgtg
acgctggacatgttggacctgggggcagccaaggcaaacttggagaaggcccaggcggag
ctggtggggacagctgacgaggccacgcgggcagagatccagatccgaatcgaggccaac
gaggccctggtgaaggccctggagtag

DBGET integrated database retrieval system