KEGG   Homo sapiens (human): 5161
Entry
5161              CDS       T01001                                 
Symbol
PDHA2, PDHAL, SPGF70
Name
(RefSeq) pyruvate dehydrogenase E1 subunit alpha 2
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5161 (PDHA2)
   00020 Citrate cycle (TCA cycle)
    5161 (PDHA2)
   00620 Pyruvate metabolism
    5161 (PDHA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5161 (PDHA2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5161 (PDHA2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    5161 (PDHA2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5161 (PDHA2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     5161 (PDHA2)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-GeneID: 5161
NCBI-ProteinID: NP_005381
OMIM: 179061
HGNC: 8807
Ensembl: ENSG00000163114
Pharos: P29803(Tbio)
UniProt: P29803
Position
4:95840093..95841464
AA seq 388 aa
MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGL
KYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG
VCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACK
YKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDY
YKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYR
TREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLE
ELGHHIYSSDSSFEVRGANPWIKFKSVS
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgctggccgccttcatctcccgcgtgttgaggcgagttgcccagaaatcagctcgcaga
gtgctggtggcatcccgtaactcctcaaatgacgctacatttgaaattaagaaatgtgat
ctttatctgttggaagagggtccccctgtcactacagtgctcactagggcggaggggctt
aaatactacaggatgatgctgactgttcgccgcatggaattgaaggcagatcagctgtac
aaacagaaattcattcgcggtttctgtcacctgtgcgatggtcaggaagcttgttgcgtg
ggccttgaggccggcataaacccctcggatcacgtcattacatcctatagggctcatggt
gtgtgctatactcggggactttctgtccgatccattctcgcagagctgacgggaagaaga
ggaggttgtgctaaaggaaaaggaggatcgatgcatatgtataccaagaacttctatggg
ggcaatggcatcgtcggtgcacagggccccctgggcgctggcattgctctggcctgtaaa
tataaaggaaacgatgagatctgtttgactttatatggggatggcgctgcgaatcagggg
cagatagccgaagctttcaatatggcagctttatggaaattaccttgtgttttcatctgt
gagaataacctatatggaatgggaacatctactgagagagcagcagccagccctgattac
tacaagaggggcaattttatccctgggctaaaggtcgatggaatggatgttctgtgtgtt
cgtgaggcaacaaaatttgcagctaactactgtagatctggaaaggggcccatactgatg
gagctgcaaacctaccgttatcatggacacagtatgagtgatcctggagtcagttatcgt
acacgagaagaaattcaggaagtaagaagtaagagggatcctataataattctccaagat
agaatggtaaacagcaagctcgccactgtggaagaattaaaggaaattggggctgaggtg
aggaaagaaattgatgatgctgcccagtttgctaccactgatcctgagccacatttggaa
gaattaggccatcacatctacagcagtgattcatcttttgaagttcgtggtgcaaatcca
tggatcaagtttaagtccgtcagttaa

DBGET integrated database retrieval system