KEGG   Homo sapiens (human): 5162
Entry
5162              CDS       T01001                                 
Symbol
PDHB, E1beta, PDHBD, PDHE1-B, PDHE1B, PHE1B
Name
(RefSeq) pyruvate dehydrogenase E1 subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  Pyruvate dehydrogenase complex deficiency
H01998  Pyruvate dehydrogenase E1-beta deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5162 (PDHB)
   00020 Citrate cycle (TCA cycle)
    5162 (PDHB)
   00620 Pyruvate metabolism
    5162 (PDHB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5162 (PDHB)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5162 (PDHB)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    5162 (PDHB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5162 (PDHB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     5162 (PDHB)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 5162
NCBI-ProteinID: NP_000916
OMIM: 179060
HGNC: 8808
Ensembl: ENSG00000168291
Pharos: P11177(Tbio)
UniProt: P11177 A0A384MDR8
Structure
Position
3:complement(58427630..58433832)
AA seq 359 aa
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcggtgtctggcttggtgcggagaccccttcgggaggtctccgggctgctgaag
aggcgctttcactggaccgcgccggctgcgctgcaggtgacagttcgtgatgctataaat
cagggtatggatgaggagctggaaagagatgagaaggtatttctgcttggagaagaagtt
gcccagtatgatggggcatacaaggttagtcgagggctgtggaagaaatatggagacaag
aggattattgacactcccatatcagagatgggctttgctggaattgctgtaggtgcagct
atggctgggttgcggcccatttgtgaatttatgaccttcaatttctccatgcaagccatt
gaccaggttataaactcagctgccaagacctactacatgtctggtggccttcagcctgtg
cctatagtcttcagagggcccaatggtgcctcagcaggtgtagctgcccagcactcacag
tgctttgctgcctggtatgggcactgcccaggcttaaaggtggtcagtccctggaattca
gaggatgctaaaggacttattaaatcagccattcgggataacaatccagtggtggtgcta
gagaatgaattgatgtatggggttccttttgaatttcctccggaagctcagtcaaaagat
tttctgattcctattggaaaagccaaaatagaaaggcaaggaacacatataactgtggtt
tcccattcaagacctgtgggccactgcttagaagctgcagcagtgctatctaaagaagga
gttgaatgtgaggtgataaatatgcgtaccattagaccaatggacatggaaaccatagaa
gccagtgtcatgaagacaaatcatcttgtaactgtggaaggaggctggccacagtttgga
gtaggagctgaaatctgtgccaggatcatggaaggtcctgcgttcaatttcctggatgct
cctgctgttcgtgtcactggtgctgatgtccctatgccttatgcaaagattctagaggac
aactctatacctcaggtcaaagacatcatatttgcaataaagaaaacattaaatatttag

DBGET integrated database retrieval system