KEGG   Homo sapiens (human): 5218Help
Entry
5218              CDS       T01001                                 

Gene name
CDK14, PFTAIRE1, PFTK1
Definition
(RefSeq) cyclin dependent kinase 14
  KO
K08821  cyclin-dependent kinase 14 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5218 (CDK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5218 (CDK14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     5218 (CDK14)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   5218 (CDK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH TruB_C_2
Motif
Other DBs
NCBI-GeneID: 5218
NCBI-ProteinID: NP_001274064
OMIM: 610679
HGNC: 8883
Ensembl: ENSG00000058091
Vega: OTTHUMG00000023649
Pharos: O94921(Tchem)
UniProt: O94921
Position
7q21.13
AA seq 469 aa AA seqDB search
MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIK
PLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSS
PSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIR
EASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQL
LRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPP
DVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGV
HSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFS
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacctcattgagccgcagccggccgagaagatcggcaagatgaagaagttgcgg
agaactttgtcggagagtttcagtcgcattgctttgaagaaagatgacaccacctttgat
gagatatgtgtcacaaagatgtctacacggaactgccagggaatggactcagtgatcaaa
cccctggacacaattcctgaggataaaaaagtcagagttcagaggacacagagcactttt
gacccatttgagaaaccagctaatcaagtaaagagggtgcattctgagaacaatgcttgc
attaactttaagacctcctccactggcaaagagtcacctaaagttaggcggcactccagc
cccagctcgccaacaagtcccaaatttggaaaagctgactcatatgaaaagctggaaaaa
ctaggggaaggatcttatgctacagtatacaaagggaaaagcaaggtaaatgggaagttg
gtagctctgaaggtgatcaggctgcaggaagaagaagggacacctttcacagctatcagg
gaagcttctcttttaaaaggactaaaacatgctaacatagtgctacttcatgacatcatc
cataccaaggagacgctgacacttgtgtttgaatatgtgcacactgatttatgtcagtac
atggacaagcaccctggggggctgcatccagataatgtgaagttgtttttatttcagttg
ctgcgaggtctgtcttacatccaccagcgttatattttgcacagagacctgaaaccacag
aaccttctgatcagtgacacgggggagttaaagctggcagatttcggtcttgcaagagca
aaatccgtccctagccacacatactccaacgaagtggttaccttgtggtacagacctcca
gatgtccttctaggctcaacagaatattccacctgccttgacatgtggggagtaggttgc
atctttgttgaaatgatccaaggagttgctgcttttccaggaatgaaagacattcaggat
caacttgaacgaatatttctggttcttggaacaccaaatgaggacacatggcctggagtt
cattctttaccacattttaagccagaacgctttaccctgtacagctctaaaaaccttaga
caagcatggaataagctcagctatgtgaaccatgcagaggacctggcctccaagctccta
caatgttccccaaagaacagactgtcggcacaggctgccttgagccacgagtattttagt
gacctgccgccacggctatgggaactcaccgacatgtcttctatttttactgtcccaaat
gtgagattgcaaccagaagctggagaaagcatgcgggcctttgggaaaaacaatagttat
ggcaaaagtctatcaaacagcaagcactga

DBGET integrated database retrieval system