KEGG   Homo sapiens (human): 5232
Entry
5232              CDS       T01001                                 

Gene name
PGK2, HEL-S-272, PGKB, PGKPS, dJ417L20.2
Definition
(RefSeq) phosphoglycerate kinase 2
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
N00737  PGAM2 deficiency in glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5232 (PGK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5232 (PGK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5232 (PGK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     5232 (PGK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5232 (PGK2)
SSDB
Motif
Pfam: PGK DUF3172
Other DBs
NCBI-GeneID: 5232
NCBI-ProteinID: NP_620061
OMIM: 172270
HGNC: 8898
Ensembl: ENSG00000170950
Vega: OTTHUMG00000014824
Pharos: P07205(Tbio)
UniProt: P07205 A0A140VJR3
Position
6p12.3
AA seq 417 aa
MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVL
MSHLGRPDGVPMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLE
NLRFHVEEEGKGQDPSGKKIKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGK
ATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV
KATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtctctttctaagaagttgactttagacaaactggatgttagagggaagcgagtcatc
atgagagtagacttcaatgttcccatgaagaagaaccagattacaaacaaccagaggatc
aaggcttccatcccaagcatcaagtactgcctggacaatggagccaaggcagtagttctt
atgagtcatctaggtcggcctgatggtgttcccatgcctgacaaatattccttagcacct
gttgctgttgagctcaaatccttgctgggcaaggatgttctgttcctgaaggactgtgta
ggcgcagaagtggagaaagcctgtgccaacccagctcctggttcagtcatcctgctggag
aacctgcgctttcatgtggaggaagaagggaagggccaagatccctctggaaagaagatt
aaagctgagccagataaaatagaagccttccgagcatcactttccaagctaggggacgtc
tatgtcaatgatgcttttggcactgcacaccgcgctcatagttccatggtgggagtgaat
ctgccccataaagcatccggattcttgatgaagaaggaactagattactttgctaaagcc
ttggaaaacccagtgagaccctttctggctatacttggtggagccaaagtggcagacaag
atccaacttatcaaaaatatgctggacaaagtcaatgagatgattattggtggtggaatg
gcttataccttccttaaggtactcaacaacatggagattggtgcttccctgtttgatgaa
gagggagccaagatcgttaaagatatcatggccaaagcacaaaagaatggtgtaaggatt
acttttcctgttgattttgttactggggacaagtttgacgagaacgctcaggttggaaaa
gccactgtagcatctggcatatctcctggctggatgggtttggactgtggtcctgagagc
aacaagaatcatgctcaagttgtggctcaagcaaggctaattgtttggaatgggccgtta
ggagtatttgaatgggatgcctttgctaagggaaccaaagccctcatggatgaaattgtg
aaagccacttccaagggctgcatcactgttatagggggtggagacactgctacttgctgt
gccaaatggaacactgaagataaagtcagccatgtcagcactggaggcggtgccagtcta
gagcttctggaaggtaaaatccttcctggagtagaggccctcagcaacatgtag

DBGET integrated database retrieval system