KEGG   Homo sapiens (human): 5245
Entry
5245              CDS       T01001                                 
Symbol
PHB1, HEL-215, HEL-S-54e, PHB
Name
(RefSeq) prohibitin 1
  KO
K17080  prohibitin 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    5245 (PHB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5245 (PHB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    5245 (PHB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5245 (PHB1)
  Exosomal proteins of breast cancer cells
   5245 (PHB1)
  Exosomal proteins of colorectal cancer cells
   5245 (PHB1)
SSDB
Motif
Pfam: Band_7 Med2
Other DBs
NCBI-GeneID: 5245
NCBI-ProteinID: NP_001268425
OMIM: 176705
HGNC: 8912
Ensembl: ENSG00000167085
Pharos: P35232(Tbio)
UniProt: P35232 A8K401
Position
17:complement(49404052..49414882)
AA seq 272 aa
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPW
VQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP
SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFT
EAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK
LEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
NT seq 819 nt   +upstreamnt  +downstreamnt
atggctgccaaagtgtttgagtccattggcaagtttggcctggccttagctgttgcagga
ggcgtggtgaactctgccttatataatgtggatgctgggcacagagctgtcatctttgac
cgattccgtggagtgcaggacattgtggtaggggaagggactcattttctcatcccgtgg
gtacagaaaccaattatctttgactgccgttctcgaccacgtaatgtgccagtcatcact
ggtagcaaagatttacagaatgtcaacatcacactgcgcatcctcttccggcctgtcgcc
agccagcttcctcgcatcttcaccagcatcggagaggactatgatgagcgtgtgctgccg
tccatcacaactgagatcctcaagtcagtggtggctcgctttgatgctggagaactaatc
acccagagagagctggtctccaggcaggtgagcgacgaccttacagagcgagccgccacc
tttgggctcatcctggatgacgtgtccttgacacatctgaccttcgggaaggagttcaca
gaagcggtggaagccaaacaggtggctcagcaggaagcagagagggccagatttgtggtg
gaaaaggctgagcaacagaaaaaggcggccatcatctctgctgagggcgactccaaggca
gctgagctgattgccaactcactggccactgcaggggatggcctgatcgagctgcgcaag
ctggaagctgcagaggacatcgcgtaccagctctcacgctctcggaacatcacctacctg
ccagcggggcagtccgtgctcctccagctgccccagtga

DBGET integrated database retrieval system