KEGG   Homo sapiens (human): 54014Help
Entry
54014             CDS       T01001                                 

Gene name
BRWD1, C21orf107, DCAF19, N143, WDR9, WRD9
Definition
(RefSeq) bromodomain and WD repeat domain containing 1
  KO
K11798  bromodomain and WD repeat domain containing protein 1/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    54014 (BRWD1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     54014 (BRWD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 54014
NCBI-ProteinID: NP_061836
OMIM: 617824
HGNC: 12760
Ensembl: ENSG00000185658
Vega: OTTHUMG00000066030
Pharos: Q9NSI6(Tdark)
UniProt: Q9NSI6
Structure
PDB: 

Position
21q22.2
AA seq 2320 aa AA seqDB search
MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHN
RSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKDCRH
TVWKGSAFAALHRGRPPEMPVNYGSPPNLVEIHRGKQLTGCSTFSTAFPGTMYQHIKMHR
RILGHLSAVYCVAFDRTGHRIFTGSDDCLVKIWSTHNGRLLSTLRGHSAEISDMAVNYEN
TMIAAGSCDKIIRVWCLRTCAPVAVLQGHTGSITSLQFSPMAKGSQRYMVSTGADGTVCF
WQWDLESLKFSPRPLKFTEKPRPGVQMLCSSFSVGGMFLATGSTDHVIRMYFLGFEAPEK
IAELESHTDKVDSIQFCNNGDRFLSGSRDGTARIWRFEQLEWRSILLDMATRISGDLSSE
EERFMKPKVTMIAWNQNDSIVVTAVNDHVLKVWNSYTGQLLHNLMGHADEVFVLETHPFD
SRIMLSAGHDGSIFIWDITKGTKMKHYFNMIEGQGHGAVFDCKFSQDGQHFACTDSHGHL
LIFGFGCSKPYEKIPDQMFFHTDYRPLIRDSNNYVLDEQTQQAPHLMPPPFLVDVDGNPH
PTKYQRLVPGRENSADEHLIPQLGYVATSDGEVIEQIISLQTNDNDERSPESSILDGMIR
QLQQQQDQRMGADQDTIPRGLSNGEETPRRGFRRLSLDIQSPPNIGLRRSGQVEGVRQMH
QNAPRSQIATERDLQAWKRRVVVPEVPLGIFRKLEDFRLEKGEEERNLYIIGRKRKTLQL
SHKSDSVVLVSQSRQRTCRRKYPNYGRRNRSWRELSSGNESSSSVRHETSCDQSEGSGSS
EEDEWRSDRKSESYSESSSDSSSRYSDWTADAGINLQPPLRTSCRRRITRFCSSSEDEIS
TENLSPPKRRRKRKKENKPKKENLRRMTPAELANMEHLYEFHPPVWITDTTLRKSPFVPQ
MGDEVIYFRQGHEAYIEAVRRNNIYELNPNKEPWRKMDLRDQELVKIVGIRYEVGPPTLC
CLKLAFIDPATGKLMDKSFSIRYHDMPDVIDFLVLRQFYDEARQRNWQSCDRFRSIIDDA
WWFGTVLSQEPYQPQYPDSHFQCYIVRWDNTEIEKLSPWDMEPIPDNVDPPEELGASISV
TTDELEKLLYKPQAGEWGQKSRDEECDRIISGIDQLLNLDIAAAFAGPVDLCTYPKYCTV
VAYPTDLYTIRMRLVNRFYRRLSALVWEVRYIEHNARTFNEPESVIARSAKKITDQLLKF
IKNQHCTNISELSNTSENDEQNAEDLDDSDLPKTSSGRRRVHDGKKSIRATNYVESNWKK
QCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCK
DIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEKLRRSQRFKQ
RQNCKGDSQPNKSIRNLKPKRLKSQTKIIPELVGSPTQSTSSRTAYLGTHKTSAGISSGV
TSGDSSDSAESSERRKRNRPITNGSTLSESEVEDSLATSLSSSASSSSEESKESSRARES
SSRSGLSRSSNLRVTRTRAAQRKTGPVSLANGCGRKATRKRVYLSDSDNNSLETGEILKA
RAGNNRKVLRKCAAVAANKIKLMSDVEENSSSESVCSGRKLPHRNASAVARKKLLHNSED
EQSLKSEIEEEELKDENQLLPVSSSHTAQSNVDESENRDSESESDLRVARKNWHANGYKS
HTPAPSKTKFLKIESSEEDSKSHDSDHACNRTAGPSTSVQKLKAESISEEADSEPGRSGG
RKYNTFHKNASFFKKTKILSDSEDSESEEQDREDGKCHKMEMNPISGNLNCDPIAMSQCS
SDHGCETDLDSDDDKIEKPNNFMKDSASQDNGLSRKISRKRVCSSDSDSSLQVVKKSSKA
RTGLLRITRRCAATAANKIKLMSDVEDVSLENVHTRSKNGRKKPLHLACTTAKKKLSDCE
GSVHCEVPSEQYACEGKPPDPDSEGSTKVLSQALNGDSDSEDMLNSEHKHRHTNIHKIDA
PSKRKSSSVTSSGEDSKSHIPGSETDRTFSSESTLAQKATAENNFEVELNYGLRRWNGRR
LRTYGKAPFSKTKVIHDSQETAEKEVKRKRSHPELENVKISETTGNSKFRPDTSSKSSDL
GSVTESDIDCTDNTKTKRRKTKGKAKVVRKEFVPRDREPNTKVRTCMHNQKDAVQMPSET
LKAKMVPEKVPRRCATVAANKIKIMSNLKETISGPENVWIRKSSRKLPHRNASAAAKKKL
LNVYKEDDTTINSESEKELEDINRKMLFLRGFRSWKENAQ
NT seq 6963 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccgtcgtccgcccgacgcccggtgcctctcatcgagtcggagctgtacttc
cttatcgcccggtacctatcggcgggcccgtgtcggagagcggcccaggtgctggtgcag
gagctggagcagtaccagttgttgccgaagagattggactgggagggcaacgagcacaac
aggagctacgaggagttggtcttgtccaataagcatgtggctcctgatcatcttttgcaa
atctgccagcgcatcggtcctatgttggataaagaaattccacccagtatttcaagagtc
acttctttacttggtgcaggaaggcagtctttgctacgtacagcaaaagactgcaggcac
acagtttggaagggctctgcctttgctgctcttcatagaggaagacctcctgaaatgcca
gtgaattatggttccccaccaaatcttgtggagatacatcgaggaaaacaactcacaggg
tgttccacttttagtacagcatttccaggaactatgtatcagcatataaaaatgcacaga
aggattctcggacatctatctgctgtttactgtgtagcatttgataggacaggacataga
atctttacaggttcagatgactgtttggtaaagatttggtcaacacataatggccgcttg
ttatctacattaagaggtcattctgcagaaatttcagatatggcagtaaactatgagaat
acaatgattgctgcggggagctgtgataaaattattagagtgtggtgcttgagaacttgt
gccccagttgctgtgctccaaggacacacaggatcaattacatctttacagtttagcccg
atggccaaaggctctcaaagatacatggtttccactggtgctgatgggacagtttgcttt
tggcaatgggatttagaatccttaaaatttagcccacgtcccctgaagttcactgaaaag
cctaggccaggcgttcaaatgctttgttcttcttttagtgttggtggtatgtttttagcc
acaggtagtactgatcatgtaatcagaatgtattttttgggttttgaagcacccgaaaaa
atcgcagaacttgaaagccacactgataaagtagatagtatccaattttgtaacaatggt
gatcggttcctaagtggtagcagagatggaacagcacggatttggagatttgagcagtta
gaatggaggagcattttattggatatggctaccagaatctcaggggacttatcttccgaa
gaggaaaggtttatgaaacctaaagtaacaatgatagcttggaatcaaaatgatagcatt
gttgtcacagctgtgaatgatcatgtcctcaaagtgtggaattcttacactggacaactg
cttcataacttaatgggacatgctgatgaagtatttgttctggagacacatccctttgat
tccagaattatgttatctgcaggacatgatggcagcatatttatatgggatattacaaaa
ggtaccaagatgaaacattattttaatatgattgaaggacaaggacatggagctgtgttt
gactgtaagttttcacaggatggacagcattttgcctgtacagattctcatgggcacctt
ctgatatttggttttggatgcagcaaaccatatgaaaagattcctgatcagatgttcttc
catactgactatcgaccacttattagagattctaataattatgtcttagatgagcaaact
cagcaggctcctcatcttatgcctccaccattcttggtagatgtagatggaaatcctcat
ccaaccaagtatcagagattagtaccaggccgagaaaattctgcagatgaacatttgatt
ccacagctgggctatgtggcaacaagtgatggagaggtgattgaacaaattataagcctg
caaaccaatgataatgatgaacgcagcccagaatcgagtattcttgatggaatgataaga
cagttgcagcagcagcaagatcagagaatgggagcagatcaggatactattccaagagga
ctttcaaatggtgaagaaacaccccggagaggttttagaaggctgagcttagacattcag
tcccctccaaatattggtctgcgtcgtagtggacaagttgaaggtgttcgtcagatgcat
caaaacgctccacgcagtcagattgctacagaacgtgacctgcaggcttggaaacgaaga
gtggttgtaccagaggtaccactaggcatatttaggaagctggaagacttccgattagag
aaaggtgaagaggaaagaaatctttatataataggaagaaaaagaaagactcttcagctc
tcacataagtcggattcagtggttttggtatcacagtctagacaaaggacatgtaggcgt
aaatatccaaattatggtagaagaaatcgtagctggcgtgagttatcttctggaaatgag
tcttcaagctctgtaagacatgagacttcctgtgatcagagtgaaggttctggttcttca
gaagaggatgaatggagaagtgacagaaaaagtgagagttacagcgaaagttcaagtgac
tcttcatctagatattccgattggacagctgatgcgggcatcaatttgcagcctccttta
agaacatcatgtcgtcgacgaattactcgattttgtagtagttcagaagatgaaatatct
actgagaatttatctcctccaaaaagaagacgaaagagaaagaaagaaaataagcctaag
aaggagaatttgcggaggatgactccagcagagcttgcaaatatggagcatttatatgaa
tttcaccctccagtttggattactgacaccacacttagaaaatctccttttgttcctcaa
atgggtgatgaggtaatatattttcgacagggtcatgaagcttatattgaggctgtaaga
agaaataatatttatgaactgaaccctaataaggagccatggagaaaaatggatcttagg
gatcaagaattggttaaaatagttggaatacgatatgaagttgggccccctacactctgt
tgcctaaaactagcatttatagatccagcaactggaaaacttatggacaaatctttctct
attagatatcatgatatgccagatgttattgactttcttgtattgcgtcaattttatgat
gaagcaagacagaggaattggcagtcttgtgacagattccgctctattattgatgatgct
tggtggtttggaacagtgttaagtcaagagccatatcaaccacagtatcctgatagtcat
ttccagtgttatattgttaggtgggataatactgaaattgaaaaacttagcccatgggac
atggaaccaattcctgataatgttgatccacctgaagaattaggagctagtatttctgtc
acaacagatgagctagagaaattgctctataaaccacaagctggtgaatggggtcagaaa
tcaagagatgaagaatgtgatagaattatcagtggtatagatcaacttttgaatcttgat
atagcagcagcttttgcaggccctgttgatttgtgtacatacccgaagtactgtactgta
gtagcttatccaaccgatctttacacaattcgaatgagacttgttaatcgattttacagg
aggctgtctgcgttagtttgggaagtcagatatatagaacataatgccagaacatttaac
gaacctgagagtgtaattgcaagatcagctaaaaagataactgaccaacttttaaaattt
atcaagaatcaacactgtacaaatatctcagaactttctaacacatctgaaaatgatgag
caaaatgctgaggatttggatgatagtgatcttcctaaaacatcttctggaaggaggaga
gtccatgatgggaaaaaaagcatcagagctacgaactatgttgaaagcaactggaagaaa
cagtgtaaggaactagtgaacttaatttttcagtgtgaagattctgaaccatttagacaa
cctgttgatttggttgaatatccagactacagagatattatagataccccaatggatttt
ggaacagtaagggaaactctagatgcgggaaattatgacagccctttggagttttgcaaa
gacatccggctgatatttagcaatgcaaaagcgtatacaccaaacaaaagatcaaagatt
tatagtatgaccttgagattatctgccttatttgaagaaaaaatgaagaaaatctcttct
gattttaaaattggtcaaaaattcaatgaaaaacttcgaagaagccagaggttcaagcaa
cggcaaaattgtaaaggtgacagtcagcctaacaaaagtatcagaaacctcaagccgaag
aggttaaaatctcagacaaaaataattcctgagttggtaggttctcctacccagtctacc
tcaagtaggacagcttatcttggaacccacaagacaagtgctggtatctcttcaggtgtt
acttctggtgactcttcagattcagcagaatcatcagaaaggaggaaaagaaatagacct
ataacaaatggttctacattatctgaaagtgaagtggaagattctttagctacctctttg
tcatcgtcagcttccagtagttctgaggaaagcaaagagagttccagagctcgtgaatcc
tcctcacgcagtgggctatccagaagcagcaatctcagggtaaccagaactagagctgct
caaagaaaaactggtcccgtttcattagcaaatggatgtggcagaaaagccactcgaaag
agagtctatttaagtgattctgataacaattcattggagactggtgaaattctaaaagcc
agagctggaaataaccgaaaagtcttaaggaagtgtgctgctgtggctgccaataaaata
aagctaatgagtgatgtagaagagaattctagctctgaaagtgtctgttctggtcggaag
ctgcctcaccgcaatgcttctgctgtagctagaaaaaagttattacataattctgaagat
gaacagagcttaaagtcagaaattgaagaagaggagctaaaagatgaaaatcaactatta
ccagtgtccagttctcacactgcccagagcaatgttgatgaatctgaaaacagagactca
gagtcagaaagtgatttgcgggtagcccggaaaaattggcatgctaatggttacaagtcc
catactccagcaccttcaaagacaaaatttcttaaaatagagtcttctgaggaagactct
aaaagtcatgattcagatcatgcatgtaacagaactgctggcccatcaacgtctgtgcag
aaacttaaggcagagagcatctcagaggaagcagattctgaaccaggaagatctggtggt
aggaaatacaatacatttcacaagaatgcgagtttctttaaaaaaaccaagattctgagt
gactcagaagactctgaatctgaagagcaagatagagaagatgggaaatgtcataaaatg
gaaatgaacccaatttcaggaaatctgaactgtgaccctattgctatgtcccagtgttcc
tcagatcatggatgtgaaactgatttagattcagatgatgacaaaatagaaaaaccaaac
aattttatgaaagattctgcatcacaagacaatggactaagcagaaaaatttccaggaaa
agggtctgttccagtgactcagacagtagtttacaggtggttaagaaatcatcaaaagcc
agaacaggtctcctgaggattactcgaagatgtgcagctacggctgccaataagatcaag
ctcatgagtgatgtagaagatgtcagtttagaaaatgtgcacactagaagcaaaaatgga
aggaaaaaacctctccatcttgcttgtactacagctaagaagaaattgagtgattgtgaa
ggaagtgtacattgtgaagtaccaagtgaacagtatgcctgtgaaggcaagccacctgat
cctgactccgaaggtagtacaaaagtgcttagtcaggctctaaatggagactcagactct
gaagatatgttgaattcagaacacaagcacaggcataccaatattcacaaaatagatgca
ccttctaaaagaaaaagttcctctgttacatcttcaggagaagattcaaaaagtcatatt
ccagggagtgagactgataggacattttcttcagagtcaaccttggcacaaaaagctact
gcagagaataattttgaagtggaactgaattatgggctgcgcaggtggaatggcagaaga
ctcaggacctatggaaaggctccttttagtaagacaaaagtgattcatgattcacaggaa
acagcagagaaggaagtaaaaaggaagagatcgcatcctgaattggaaaatgtgaaaatc
tctgaaacaactgggaattcaaagtttagacctgatactagttccaaatcatcagatttg
ggatctgtaactgaatcagatattgactgtactgataatacaaaaaccaaaaggaggaaa
acgaaaggaaaagcaaaagtagttagaaaagaatttgttcctagagacagagaacccaat
acaaaagtgagaacatgtatgcataatcagaaggatgcagtgcagatgcctagtgaaact
ctgaaagcaaaaatggtacctgagaaagttccccgcagatgtgctactgttgctgcaaat
aaaataaagataatgagtaatctaaaagaaacgatctcaggaccagaaaatgtctggatt
aggaagagtagcagaaaactgccccatcgaaatgcttctgctgcggctaagaaaaaatta
ctgaatgtttataaagaggatgatacaaccataaattctgaaagtgaaaaagagctagaa
gatattaatagaaaaatgctttttttaagggggttcagatcctggaaagaaaatgcacaa
tag

DBGET integrated database retrieval system