KEGG   Homo sapiens (human): 55288Help
Entry
55288             CDS       T01001                                 

Gene name
RHOT1, ARHT1, MIRO-1, MIRO1
Definition
(RefSeq) ras homolog family member T1
  KO
K07870  mitochondrial Rho GTPase 1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    55288 (RHOT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    55288 (RHOT1)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    55288 (RHOT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     55288 (RHOT1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    55288 (RHOT1)
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    55288 (RHOT1)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rho Family
   Miro
    55288 (RHOT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF_assoc_2 EF_assoc_1 Ras Roc Arf MMR_HSR1 EF-hand_1 EF-hand_6 EF-hand_7 RsgA_GTPase SRPRB Dynamin_N Rad4 AAA_15 AAA_22 EF-hand_8 AAA_16
Motif
Other DBs
NCBI-GeneID: 55288
NCBI-ProteinID: NP_060777
OMIM: 613888
HGNC: 21168
Ensembl: ENSG00000126858
Vega: OTTHUMG00000179564
Pharos: Q8IXI2(Tbio)
UniProt: Q8IXI2
Structure
PDB: 

Position
17q11.2
AA seq 618 aa AA seqDB search
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSE
AEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKS
DLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
MKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDG
VADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQ
GFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFR
CNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESE
FLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSI
SPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGA
TVFAVLGFAMYKALLKQR
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagacgtgcggatcctgctggtgggagaacctagagttgggaagacatcactg
attatgtctctggtcagtgaagaatttccagaagaggttcctccccgggcagaagaaatc
accattccagctgatgtcaccccagagagagttccaacacacattgtagattactcagaa
gcagaacagagtgatgaacaacttcatcaagaaatatctcaggctaatgtcatctgtata
gtgtatgccgttaacaacaagcattctattgataaggtaacaagtcgatggattcctctc
ataaatgaaagaacagacaaagacagcaggctgcctttaatattggttgggaacaaatct
gatctggtggaatatagtagtatggagaccatccttcctattatgaaccagtatacagaa
atagaaacctgtgtggagtgttcagcgaaaaacctgaagaacatatcagagctcttttat
tacgcacagaaagctgttcttcatcctacagggcccctgtactgcccagaggagaaggag
atgaaaccagcttgtataaaagcccttactcgtatatttaaaatatctgatcaagataat
gatggtactctcaatgatgctgaactcaacttctttcagaggatttgtttcaacactcca
ttagctcctcaagctctggaggatgtcaagaatgtagtcagaaaacatataagtgatggt
gtggctgacagtgggttgaccctgaaaggttttctctttttacacacactttttatccag
agagggagacacgaaactacttggactgtgcttcgacgatttggttatgatgatgacctg
gatttgacacctgaatatttgttccccctgctgaaaatacctcctgattgcactactgaa
ttaaatcatcatgcatatttatttctccaaagcacctttgacaagcatgatttggataga
gactgtgctttgtcacctgatgagcttaaagatttatttaaagttttcccttacatacct
tgggggccagatgtgaataacacagtttgtaccaatgaaagaggctggataacctaccag
ggattcctttcccagtggacgctcacgacttatttagatgtacagcggtgcctggaatat
ttgggctatctaggctattcaatattgactgagcaagagtctcaagcttcagctgttaca
gtgacaagagataaaaagatagacctgcagaaaaaacaaactcaaagaaatgtgttcaga
tgtaatgtaattggagtgaaaaactgtgggaaaagtggagttcttcaggctcttcttgga
agaaacttaatgaggcagaagaaaattcgtgaagatcataaatcctactatgcgattaac
actgtttatgtatatggacaagagaaatacttgttgttgcatgatatctcagaatcggaa
tttctaactgaagctgaaatcatttgtgatgttgtatgcctggtatatgatgtcagcaat
cccaaatcctttgaatactgtgccaggatttttaagcaacactttatggacagcagaata
ccttgcttaatcgtagctgcaaagtcagacctgcatgaagttaaacaagaatacagtatt
tcacctactgatttctgcaggaaacacaaaatgcctccaccacaagccttcacttgcaat
actgctgatgcccccagtaaggatatctttgttaaattgacaacaatggccatgtatccg
cacgtgacacaagctgacctcaagagctccacgttttggcttcgagcaagttttggtgct
actgtttttgcagttttgggctttgctatgtacaaagcattattgaaacagcgatga

DBGET integrated database retrieval system