KEGG   Homo sapiens (human): 55577Help
Entry
55577             CDS       T01001                                 

Gene name
NAGK, GNK, HSA242910
Definition
(RefSeq) N-acetylglucosamine kinase
  KO
K00884  N-acetylglucosamine kinase [EC:2.7.1.59]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    55577 (NAGK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.59  N-acetylglucosamine kinase
     55577 (NAGK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BcrAD_BadFG ROK
Motif
Other DBs
NCBI-GeneID: 55577
NCBI-ProteinID: NP_060037
OMIM: 606828
HGNC: 17174
Ensembl: ENSG00000124357
Vega: OTTHUMG00000153239
Pharos: Q9UJ70(Tbio)
UniProt: Q9UJ70 A0A384N6G7
Structure
PDB: 

Position
2p13.3
AA seq 344 aa AA seqDB search
MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKA
GVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGG
VVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHD
IGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGE
MLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFS
SFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgatctatgggggtgtagaggggggaggcacacgatccgaggtccttttagtc
tcagaggatgggaagatcctggcagaagcagatggactgagcacaaaccactggctgatc
gggacagacaagtgtgtggagaggatcaatgagatggtgaacagggccaaacggaaagca
ggggtggatcctctggtaccgctgcgaagcttgggcctatctctgagcggtggggaccag
gaggacgcggggaggatcctgatcgaggagctgagggaccgatttccctacctgagtgaa
agctacttaatcaccaccgatgccgccggctccatcgccacagctacaccggatggtgga
gttgtgctcatatctggaacaggctccaactgcaggctcatcaaccctgatggctccgag
agtggctgcggcggctggggccatatgatgggtgatgagggttcagcctactggatcgca
caccaagcagtgaaaatagtgtttgactccattgacaacctagaggcggctcctcatgat
atcggctacgtcaaacaggccatgttccactatttccaggtgccagatcggctagggata
ctcactcacctgtatagggactttgataaatgcaggtttgctgggttttgccggaaaatt
gcagaaggtgctcagcagggagaccccctttcccgctatatcttcaggaaggctggggag
atgctgggcagacacatcgtagcagtgttgcccgagattgacccggtcttgttccagggc
aagattggactccccatcctgtgcgtgggctctgtgtggaagagctgggagctgctgaag
gaaggttttcttctggcgctgacccagggcagagagatccaggctcagaacttcttctcc
agcttcaccctgatgaagctgaggcactcctccgctctgggtggggccagcctaggggcc
aggcacatcgggcacctcctccccatggactatagcgccaatgccattgccttctattcc
tacaccttttcctag

DBGET integrated database retrieval system