KEGG   Homo sapiens (human): 55654Help
Entry
55654             CDS       T01001                                 

Gene name
TMEM127
Definition
(RefSeq) transmembrane protein 127
Organism
hsa  Homo sapiens (human)
Disease
H01510  Malignant paraganglioma
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 55654
NCBI-ProteinID: NP_001180233
OMIM: 613403
HGNC: 26038
Ensembl: ENSG00000135956
Vega: OTTHUMG00000130454
Pharos: O75204(Tbio)
UniProt: O75204
Position
2q11.2
AA seq 238 aa AA seqDB search
MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGT
CSRQELGVSDVLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKH
PALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLV
AGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcccccggaggcgcagggctgcccggcgggcgccggcggaggagcccgggaggc
agcgctctgcccaagcagccggagcgtagcctggcctcggccctgcctggcgccctgtct
atcacggcgctgtgcactgccctcgccgagcccgcctggttgcacatccacggaggcacc
tgttcgcgccaggagctgggggtctccgacgtgttgggctatgtgcacccggacctgctg
aaagatttctgcatgaatccccagacagtgctgctcctgcgggtcatcgccgccttctgt
ttcctgggcatcctgtgtagtctctccgctttccttctggatgtctttgggccgaagcat
cctgctctgaagatcactcgtcgctatgccttcgcccatatcctaacggttctgcagtgt
gccaccgtcattggcttttcttattgggcttctgaactcatcttggcccagcagcagcag
cataagaagtaccatggatcccaggtctatgtcaccttcgccgttagcttctacctggtg
gcaggagctggtggagcctcaatcctggccacggcagccaacctcctgcgccactacccc
acagaggaagaggagcaggcgctggagctgctctcagagatggaagagaacgagccctac
ccggcggaatatgaggtcatcaaccagttccagccaccccctgcttacacaccctaa

DBGET integrated database retrieval system