KEGG   Homo sapiens (human): 55813Help
Entry
55813             CDS       T01001                                 

Gene name
UTP6, C17orf40, HCA66
Definition
(RefSeq) UTP6 small subunit processome component
  KO
K14557  U3 small nucleolar RNA-associated protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    55813 (UTP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    55813 (UTP6)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    55813 (UTP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: U3_assoc_6 NRDE-2
Motif
Other DBs
NCBI-GeneID: 55813
NCBI-ProteinID: NP_060898
HGNC: 18279
Ensembl: ENSG00000108651
Vega: OTTHUMG00000132815
Pharos: Q9NYH9(Tbio)
UniProt: Q9NYH9
Position
17q11.2
AA seq 597 aa AA seqDB search
MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQY
EINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKW
ATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYK
EYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHV
SLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
EVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLERFTKKSNSGFLRGKRLERTMTVFRK
AHELKLLSECQYKQLSVSLLCYNFLREALEVAVAGTELFRDSGTMWQLKLQVLIESKSPD
IAMLFEEAFVHLKPQVCLPLWISWAEWSEGAKSQEDTEAVFKKALLAVIGADSVTLKNKY
LDWAYRSGGYKKARAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREF
GSADSDLWMDYMKEELNHPLGRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcagagataattcaggaacgcatagaagatcggctcccggaattggaacagctggag
cgcattggactgttcagtcatgcggagattaaggctatcattaagaaggcttccgatcta
gagtacaaaatccagagaagaacccttttcaaggaagactttatcaattatgttcaatat
gaaattaatcttttggagctgatccagagaagaagaacacgcattggatattcatttaag
aaggatgagattgagaattctattgtacaccgggtacaaggtgttttccagcgtgcctca
gcaaaatggaaagacgatgttcaactttggctctcctatgtggctttttgtaagaagtgg
gctactaaaactcgacttagcaaggtattctctgccatgttggcgattcattccaacaaa
ccagctttgtggattatggcagccaaatgggaaatggaagatcgattgtcttcagaaagc
gcaaggcaactatttcttcgcgcactgcgctttcatccagagtgcccaaaactttataaa
gaatactttaggatggagctgatgcatgctgaaaaactgaggaaggagaaggaagaattt
gaaaaagccagtatggatgtggagaatcctgattattctgaagaaatccttaagggcgag
ttggcatggatcatctacaaaaattctgtaagcataattaaaggtgcagaatttcacgtg
tcactgctttcgattgcacagctatttgactttgccaaagatctacaaaaagagatttat
gatgaccttcaggctctacacacagatgatcctctcacttgggattatgtggcaaggcga
gaattagagattgagtcacagacagaagagcagcctacaacgaaacaagccaaagcagtg
gaggtcggccggaaggaggagaggtgctgtgctgtgtatgaagaggcagtgaagactctg
ccaacagaggccatgtggaagtgttacatcaccttttgcttggaaagatttactaagaag
tcaaatagtgggttccttagagggaagaggttggaaagaaccatgactgtattcaggaag
gcacatgaactgaagcttctgtcagaatgccaatacaagcagttgagtgtttcgttgctg
tgttataacttcctgagggaagctctggaagtggcagtagctggaactgaattgtttaga
gactctgggacaatgtggcagctgaagctgcaggtgctgatcgagtcaaagagccctgac
atagccatgctttttgaagaagcctttgtgcacctgaaaccccaggtttgtctgccattg
tggatttcctgggcagagtggagtgaaggtgccaaaagccaagaagacactgaggcagtc
tttaagaaagctctcttagctgtcataggtgccgactcagtaaccctgaagaataagtac
ctggattgggcttatcgaagtggtggctacaaaaaggccagagctgtgtttaaaagttta
caggagagccgaccattttcagttgactttttcaggaaaatgattcagtttgaaaaggag
caagaatcctgcaatatggcgaacataagagaatattatgagagagctttgagagagttt
ggatccgcagattctgatctttggatggattatatgaaagaagaattgaaccaccccctt
ggtagacctgagaactgtggacagatctactggcgagcgatgaaaatgttgcagggagag
tcagcagaggcatttgtagctaaacatgctatgcatcagactggccatttatga

DBGET integrated database retrieval system