KEGG   Homo sapiens (human): 55823Help
Entry
55823             CDS       T01001                                 

Gene name
VPS11, END1, HLD12, PEP5, RNF108, hVPS11
Definition
(RefSeq) VPS11 core subunit of CORVET and HOPS complexes
  KO
K20179  vacuolar protein sorting-associated protein 11
Organism
hsa  Homo sapiens (human)
Disease
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55823 (VPS11)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    55823 (VPS11)
   Hops complex
    55823 (VPS11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VPS11_C Clathrin zf-C3HC4_2 zf-RING_2 zf-rbx1 zf-C3HC4 zf-C3H2C3 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 TPR_11 zf-ANAPC11 zf-RING-like zf-C3HC4_4 DLP_helical
Motif
Other DBs
NCBI-GeneID: 55823
NCBI-ProteinID: NP_068375
OMIM: 608549
HGNC: 14583
Ensembl: ENSG00000160695
Vega: OTTHUMG00000166355
Pharos: Q9H270(Tbio)
UniProt: Q9H270 B7Z879 A0A087WXL6
Position
11q23.3
AA seq 941 aa AA seqDB search
MAAYLQWRRFVFFDKELVKEPLSNDGAAPGATPASGSAASKFLCLPPGITVCDSGRGSLV
FGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILASVGEDEEGINPLVKIWNLEK
RDGGNPLCTRIFPAIPGTEPTVVSCLTVHENLNFMAIGFTDGSVTLNKGDITRDRHSKTQ
ILHKGNYPVTGLAFRQAGKTTHLFVVTTENVQSYIVSGKDYPRVELDTHGCGLRCSALSD
PSQDLQFIVAGDECVYLYQPDERGPCFAFEGHKLIAHWFRGYLIIVSRDRKVSPKSEFTS
RDSQSSDKQILNIYDLCNKFIAYSTVFEDVVDVLAEWGSLYVLTRDGRVHALQEKDTQTK
LEMLFKKNLFEMAINLAKSQHLDSDGLAQIFMQYGDHLYSKGNHDGAVQQYIRTIGKLEP
SYVIRKFLDAQRIHNLTAYLQTLHRQSLANADHTTLLLNCYTKLKDSSKLEEFIKKKSES
EVHFDVETAIKVLRQAGYYSHALYLAENHAHHEWYLKIQLEDIKNYQEALRYIGKLPFEQ
AESNMKRYGKILMHHIPEQTTQLLKGLCTDYRPSLEGRSDREAPGCRANSEEFIPIFANN
PRELKAFLEHMSEVQPDSPQGIYDTLLELRLQNWAHEKDPQVKEKLHAEAISLLKSGRFC
DVFDKALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVISVCERHGEQDPSLW
EQALSYFARKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQ
KQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGH
SFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIAD
YFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctacctgcagtggcggcgcttcgttttcttcgacaaggagctggtgaaggag
ccgctgagcaatgatggggccgctcccggggccacacctgcttctggatccgctgcttcc
aagttcctttgcctccctcctggcatcactgtctgcgactcaggccgagggagcctggtc
tttggagatatggaaggccagatctggttcttgccacgttccctacagcttacaggcttc
caagcctacaaactacgggtgacacacctgtaccaactgaagcagcacaatattctggca
tctgttggagaagatgaagagggcatcaaccccttggttaagatctggaacctggagaag
agagatggtggcaatccactctgcactcgaatcttccctgctattccaggaacagagcca
actgttgtatcttgtttgactgtccatgaaaatctcaactttatggccattggtttcaca
gatggcagtgttacattgaacaaaggagacatcacccgggaccggcatagcaagacccag
attttgcacaagggcaactatcctgtaactggattggcctttcgccaagcaggaaagacc
actcacttgtttgttgtgacaacagagaacgtccagtcctatatagtttctggaaaagac
taccctcgcgtggagttggacacccatggttgtggcctgcgctgctcagccctaagtgac
ccttctcaggacctgcagttcattgtggccggggatgagtgtgtctacttgtaccagcct
gatgaacgtgggccctgcttcgcctttgagggccataagctcattgcccactggtttaga
ggctaccttatcattgtctcccgtgaccggaaggtttctcccaagtcagagtttaccagc
agggattcacagagctccgacaagcagattctaaacatctatgacctgtgcaacaagttc
atagcctatagcaccgtctttgaggatgtagtggatgtgcttgctgagtggggctccctg
tacgtgctgacgcgggatgggcgggtccacgcactgcaggagaaggacacacagaccaaa
ctggagatgctgtttaagaagaacctatttgagatggcgattaaccttgccaagagccag
catctggacagtgatgggctggcccagattttcatgcagtatggagaccatctctacagc
aagggcaaccacgatggggctgtccagcaatatatccgaaccattggaaagttggagcca
tcctacgtgatccgcaagtttctggatgcccagcgcattcacaacctgactgcctacctg
cagaccctgcaccgacaatccctggccaatgccgaccataccaccctgctcctcaactgc
tataccaagctcaaggacagctcgaagctggaggagttcatcaagaaaaagagtgagagt
gaagtccactttgatgtggagacagccatcaaggtcctccggcaggctggctactactcc
catgccctgtatctggcggagaaccatgcacatcatgagtggtacctgaagatccagcta
gaagacattaagaattatcaggaagcccttcgatacatcggcaagctgccttttgagcag
gcagagagcaacatgaagcgctacggcaagatcctcatgcaccacataccagagcagaca
actcagttgctgaagggactttgtactgattatcggcccagcctcgaaggccgcagcgat
agggaggccccaggctgcagggccaactctgaggagttcatccccatctttgccaataac
ccgcgagagctgaaagccttcctagagcacatgagtgaagtgcagccagactcaccccag
gggatctacgacacactccttgagctgcgactgcagaactgggcccacgagaaggatcca
caggtcaaagagaagcttcacgcagaggccatttccctgctgaagagtggtcgcttctgc
gacgtctttgacaaggccctggtcctgtgccagatgcacgacttccaggatggtgtcctt
tacctttatgagcaggggaagctgttccagcagatcatgcactaccacatgcagcacgag
cagtaccggcaggtcatcagcgtgtgtgagcgccatggggagcaggacccctccttgtgg
gagcaggccctcagctacttcgctcgcaaggaggaggactgcaaggagtatgtggcagct
gtcctcaagcatatcgagaacaagaacctcatgccacctcttctagtggtgcagaccctg
gcccacaactccacagccacactctccgtcatcagggactacctggtccaaaaactacag
aaacagagccagcagattgcacaggatgagctgcgggtgcggcggtaccgagaggagacc
acccgtatccgccaggagatccaagagctcaaggccagtcctaagattttccaaaagacc
aagtgcagcatctgtaacagtgccttggagttgccctcagtccacttcctgtgtggccac
tccttccaccaacactgctttgagagttactcggaaagtgatgctgactgccccacctgc
ctccctgaaaaccggaaggtcatggatatgatccgggcccaggaacagaaacgagatctc
catgatcaattccagcatcagctcaagtgctccaatgacagcttttctgtgattgctgac
tactttggcagaggtgttttcaacaaattgactctgctgaccgaccctcccacagccaga
ctgacctccagcctggaggctgggctgcaacgcgacctactcatgcactccaggaggggc
acttaa

DBGET integrated database retrieval system