KEGG   Homo sapiens (human): 55843Help
Entry
55843             CDS       T01001                                 

Gene name
ARHGAP15, BM046
Definition
(RefSeq) Rho GTPase activating protein 15
  KO
K20637  Rho GTPase-activating protein 15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55843 (ARHGAP15)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    55843 (ARHGAP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP PH PH_9
Motif
Other DBs
NCBI-GeneID: 55843
NCBI-ProteinID: NP_060930
OMIM: 610578
HGNC: 21030
Ensembl: ENSG00000075884
Vega: OTTHUMG00000131845
Pharos: Q53QZ3(Tbio)
UniProt: Q53QZ3
Structure
PDB: 

Position
2q22.2-q22.3
AA seq 475 aa AA seqDB search
MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKES
KQQALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHH
SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKA
SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatctacaaattctgatacttccgtggaaacactgaattctacccgccaaggc
acaggagctgtgcaaatgagaatcaaaaatgccaacagccaccatgacaggctcagccaa
agtaaatccatgatcctcaccgatgtcgggaaggtcactgaacctatatccagacacaga
aggaatcattcacagcatatcttgaaagatgtcattcctccattggaacaactgatggtt
gaaaaagaaggttatctgcaaaaagctaaaattgcagatggaggaaagaaactaaggaaa
aactggtctacttcctggattgttctttctagtcgaagaattgaattttacaaagaatcc
aagcaacaggctctgtccaatatgaaaactgggcacaaaccagaaagtgtggatttgtgt
ggagcacacattgaatgggccaaggaaaaatcgagcagaaagaatgtctttcagatcaca
acagtatcaggaaatgagttccttctacagtcagatattgacttcatcatattggattgg
ttccacgctatcaaaaatgcaattgacagattgccaaaggattcaagttgtccatcaaga
aacctggaattattcaaaatccaaagatcctctagcactgaattgctaagtcactacgac
agtgatataaaagaacagaaaccagagcacagaaaatctttaatgttcagactgcatcac
agtgcttccgatacaagcgacaaaaatcgagttaaaagcagattaaagaagtttattacc
cgaagaccttccctgaaaactctgcaagaaaaaggacttattaaagatcaaatttttggc
tctcatctgcacaaagtgtgtgaacgtgaaaattccacagttccgtggtttgtaaagcaa
tgcattgaagctgttgagaaaagaggtctagatgttgatggaatatatcgagttagtggc
aatctggcaacaatacagaagttaagatttattgtcaaccaagaagagaagctgaatttg
gacgacagccagtgggaggacatccacgttgtcaccggagcactgaagatgtttttccgg
gagctgcctgagccgctcttcccttacagtttctttgagcagtttgtggaagcgatcaaa
aagcaagacaacaacacaagaattgaagctgtaaaatctcttgtacaaaaactccctccg
ccaaatcgtgacaccatgaaagtcctctttggacatctaactaagatagtggccaaagcc
tccaagaacctcatgtccacgcaaagcttggggattgtatttggacctacccttctgcga
gctgaaaatgaaacaggaaacatggcgatccacatggtctaccagaaccagatagctgag
ctcatgctgagtgagtacagtaagatcttcggctcagaggaagactga

DBGET integrated database retrieval system