KEGG   Homo sapiens (human): 56098
Entry
56098             CDS       T01001                                 

Gene name
PCDHGC4, PCDH-GAMMA-C4
Definition
(RefSeq) protocadherin gamma subfamily C, 4
  KO
K16497  protocadherin gamma subfamily C
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    56098 (PCDHGC4)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Protocadherins
   56098 (PCDHGC4)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2
Other DBs
NCBI-GeneID: 56098
NCBI-ProteinID: NP_061751
OMIM: 606305
HGNC: 8717
Ensembl: ENSG00000242419
Vega: OTTHUMG00000129625
Pharos: Q9Y5F7(Tdark)
UniProt: Q9Y5F7
Position
5q31.3
AA seq 938 aa
MLRKVRSWTEIWRWATLLFLFYHLGYVCGQIRYPVPEESQEGTFVGNVAQDFLLDTDSLS
ARRLQVAGEVNQRHFRVDLDSGALLIKNPIDREALCGLSASCIVPLEFVTEGPLEMYRAE
VEIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFAL
DVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAP
AFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLHPTTG
KLTLLGPLDFESENYYEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYITVTSELGTLP
ESAEPGTVVALISVQDPDSGSNGDVSLRIPDHLPFALKSAFRNQFSLVTAGPLDREAKSS
YDIMVTASDAGNPPLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAAS
DPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDR
GNPPLSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDS
GYNAWVSYQLLEAPDPSLFAVSRYAGEVRTAVPIPADLPPQKLVIVVKDSGSPPLSTSVT
LLVSLEEDTHPVVPDLRESSAPREGESRLTLYLAVSLVAICFVSFGSFVALLSKCLRGAA
CGVTCFPAGTCACLTRSRRREGLPPSNGILRIQLGSDDPIKFVDVGGHSHGCTPLASAPT
RSDSFMMVKSPSAPMAGEPVRPSCPPSDLLYGLEQAPPNTDWRFSQAQRPGTSGSQNGDD
TGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQN
VYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgctccgcaaggtgagaagctggacagaaatctggcggtgggctacccttttgttcctc
ttttaccacctgggttacgtttgtgggcagatccgctacccggtcccagaggagtcacag
gaagggacttttgtagggaatgtcgctcaagatttcctgctggatacggacagtctgtca
gctcgcaggctgcaggtcgctggagaggtgaaccaaagacacttccgtgtggatttggac
agcggagccctgctcatcaagaacccaatcgaccgagaggcactgtgtgggctcagtgcc
agctgcatcgtgcccctggagtttgtcaccgaaggtcctttggaaatgtaccgagcagag
gtagagatcgtagatgtgaatgatcacgccccccgttttccgcggcagcagctggacttg
gaaattggggaggcagctcctccaggacagcgtttcccgttggaaaaggctcaggatgca
gatgtggggagcaattcgattagcagctataggctgagctccaatgaacactttgcactg
gatgtgaagaagcgcagcgacggcagcctggtcccagagctgctcctggagaagcctttg
gatcgagagaagcaatcggactaccgcctggtgctgactgctgtcgatggagggaacccg
ccgagatctggcaccgcagagctccgggtatccgtgctggacgtaaacgacaacgcccca
gccttccagcaatccagctacaggattagtgtgttggagagcgcaccagcgggcatggtg
ctcatccagctcaatgcctcagacccggacctgggtcccagtggtaacgtcaccttttat
ttcagtggtcatacccctgatcgtgtaagaaacctctttagcctgcaccccactactgga
aagcttactcttttggggcccctagactttgagagtgagaattactatgaatttgatgtg
cgggctcgcgatgggggttctccagccatggagcaacattgcagccttcgagtggatctg
ctggacgtaaatgacaatgccccttacatcacagtgacctcagagcttggaaccctcccc
gagagtgcagaacctggcactgtggtggcacttatcagtgtgcaggatccagactcaggg
tcaaacggagatgtgagcctccgcattcctgaccacttgccatttgccctcaagtctgcc
ttcaggaaccagttctccctggtgactgctggacccttggatcgagaggccaaatctagc
tatgacatcatggtcactgcttctgatgctgggaaccctcctctcagtacccacagaact
attttcctcaatatttcagatgtgaatgataatccaccctctttctttcagaggtcacat
gaggtgtttgttcctgagaacaatcgcccaggggacctgctttgctcccttgcagcctct
gacccagactctggcttgaatgcgcttatctcctactcactcctggagcccaggaatcga
gatgtatcagcttcctctttcatctctctgaacccccagacaggagctgttcatgctact
cgatcctttgactatgagcaaacccagacactgcagtttgaggtgcaggcccgggatcgg
ggcaacccaccccttagcagcactgtaacagttcgtctatttgtgctggacctcaatgac
aatgctccagctgtgctccgtcctcgggcccggcctggttccttatgtccccaagcactg
cctccatcagttggtgctggccacctaatcacaaaggtgactgctgtggacttggattca
ggttacaatgcttgggtttcctatcagctcctggaggccccagatcccagcctgtttgca
gtctctcgatatgctggggaggtgcggacggctgttcctatcccagctgacctcccacca
cagaagctggtcattgtggtaaaggatagtggtagtccaccactctctacctctgttact
ctcttagtgtccttagaggaagacactcatccagttgtcccagatcttcgagaatcttca
gctccaagggaaggagaatctcgtctaaccctctacttggctgtgtccctagtggcaatt
tgctttgtctcctttggctcattcgtggcactactctctaagtgtcttcgtggggcagcc
tgtggagtcacatgctttcctgctggcacctgtgcctgtctcaccagatctcgaaggagg
gaggggcttcccccttccaatgggatcctccgaatccagctagggtcagatgaccctatc
aagtttgttgatgtgggaggccactctcatggctgtacacccttggcttctgcacccact
cggagtgatagcttcatgatggtgaagtcacccagtgcacctatggcaggggagcctgtt
cgcccaagctgcccaccctctgatcttctctatgggctagagcaagccccgcccaacacg
gactggcgtttctctcaggcccagagacccggcaccagcggctcccaaaatggcgatgac
accggcacctggcccaacaaccagtttgacacagagatgctgcaagccatgatcttggcg
tccgccagtgaagctgctgatgggagctccaccctgggagggggtgccggcaccatggga
ttgagcgcccgctacggaccccagttcaccctgcagcacgtgcccgactaccgccagaat
gtctacatcccaggcagcaatgccacactgaccaacgcagctggcaagcgggatggcaag
gccccagcaggtggcaatggcaacaagaagaagtcgggcaagaaggagaagaagtaa

DBGET integrated database retrieval system