KEGG   Homo sapiens (human): 56104Help
Entry
56104             CDS       T01001                                 

Gene name
PCDHGB1, PCDH-GAMMA-B1
Definition
(RefSeq) protocadherin gamma subfamily B, 1
  KO
K16496  protocadherin gamma subfamily B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    56104 (PCDHGB1)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Protocadherins
   56104 (PCDHGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2 Cadherin_3
Motif
Other DBs
NCBI-GeneID: 56104
NCBI-ProteinID: NP_061745
OMIM: 606299
HGNC: 8708
Ensembl: ENSG00000254221
Vega: OTTHUMG00000163681
Pharos: Q9Y5G3(Tdark)
UniProt: Q9Y5G3
Position
5q31.3
AA seq 927 aa AA seqDB search
MQRAREAEMMKSQVLFPFLLSLFCGAISQQIRYTIPEELANGSRVGKLAKDLGLSVRELP
TRKLRVSAEDYFNVSLESGDLLVNGRIDREKICGRKLECALEFETVAENPMNVFHVVVVI
QDINDNAPRFVAKGIDLEICESALPGVKFSLDSAQDADVEGNSLKLYTINPNQYFSLSTK
ESPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTDANDNAPVFS
QEVYRVSLQENVPWGTSVLRVMATDQDEGINAEITYAFLNSPISTSLFNLNPNTGDITTN
GTLDFEETSRYVLSVEAKDGGVHTAHCNVQIEIVDENDNAPEVTFMSFSNQIPEDSDLGT
VIALIKVRDKDSGQNGMVTCYTQEEVPFKLESTSKNYYKLVIAGALNREQTADYNVTIIA
TDKGKPALSSRTSITLHISDINDNAPVFHQASYVVHVSENNPPGASIAQVSASDPDLGPN
GRVSYSILASDLEPRELLSYVSVSPQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSA
NVSLRVLVGDLNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWL
SYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLIF
ADSLQEVLPDLSDRPEPSDPQTELQFYLVVALALISVLFLLAVILAIALRLRRSSSLDTE
GCFQTGLCSKSGPGVPPNHSEGTLPYSYNLCIASHSAKTEFNSLNLTPEMAPPQDLLCDD
PSMVVCASNEDHKIAYDPSLSSHQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDT
EMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLT
NAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagccagagaagccgaaatgatgaaaagtcaggtactgtttcccttcctgctg
tctttgttctgcggggccatctcccagcagatccgatacacgattccagaggagctagcc
aacggctcacgggtggggaaacttgccaaggatctggggctcagtgtccgggagttgcca
actcgaaaactgcgggttagtgcagaggattatttcaacgttagtttggagagcggggat
ttgttagtgaacggtaggatagatcgagagaagatttgcggaaggaaacttgagtgtgca
ctagaattcgaaacggtcgctgaaaacccaatgaatgttttccacgtggttgttgtaatc
caagatattaatgacaatgcaccacgtttcgttgcaaaaggcattgacttagaaatttgt
gagtcagccttacccggggtaaaattctctctggattctgctcaagatgcagatgtggaa
ggcaattcactgaagttatacaccatcaaccccaatcaatacttctctctgtcaacgaag
gaaagtcctgatggaagtaaatatccggtattactgctggaaaaacctctagacagggaa
catcagagctctcatcgcttaatcctgactgccatggatggcggggacccgcctctaagc
ggcaccacccatatctggatccgagttacggatgccaatgataatgctcccgtgtttagc
caggaggtatacagggttagcctccaagaaaacgtaccgtggggaacctccgtgctgcgg
gtgatggccacagaccaggatgagggcattaatgcagagatcacctatgccttcctcaat
tccccaataagtaccagcctcttcaatctcaatccaaatactggcgacatcacaaccaat
ggcacattggattttgaagagacaagtagatatgtgttgagtgtggaagctaaggatgga
ggagtacacacagctcactgtaatgttcaaatagaaattgttgacgagaatgacaatgcc
ccagaggtgacattcatgtccttctctaaccagattccagaggattcagaccttggaact
gtaatagccctcataaaagtgcgagacaaggattctgggcaaaatggcatggtgacatgc
tatactcaggaagaagttcctttcaaattagaatccacctcgaagaattattacaagctg
gtgattgctggagccctaaaccgggagcagacagcagactacaacgtcacaatcatagcc
accgacaagggcaaaccagccctttcctccaggacaagcatcaccctgcacatctccgac
atcaacgacaatgcacctgttttccatcaggcctcctatgtggtccacgtgtctgagaac
aacccacctggcgcctccattgcacaagtaagcgcctccgacccggatttgggacccaac
ggcagagtctcctactctattctggccagtgacctggagccgcgggagctgttgtcctac
gtgtccgtgagcccgcagagcggggtggtgttcgcgcagcgcgccttcgaccacgagcag
ctgcgcgccttcgagctcacactgcaggccagggaccagggctcccccgcgctcagcgcc
aacgtgagcctgcgcgtgttggtgggcgacctcaatgacaatgcgccacgggtgctgtac
cccgcgctggggcctgatggctccgccctcttcgatatggtgccacgcgccgcagagccc
ggctacctggtgaccaaggtggtggcggtggacgcagactcaggacacaacgcttggctg
tcctaccacgtgctgcaggccagcgagcccgggctcttcagcctggggttgcgcacgggt
gaggtgcgcacagcgcgtgccttgggcgacagggacgcggcccgccagcgcctgctggtc
gctgtgcgtgatggaggacagccgccactctccgccaccgccacgctgcacctaatcttc
gcggatagcctgcaagaggtattgccagacctcagcgaccgccctgagccctctgacccc
cagacggaactgcagttttacctggttgtggccttggccttgatctcagtgctctttctc
ctcgcggtgattctagcgatcgccctgcgcctgcgacgttcctccagcctcgacactgag
ggctgctttcaaaccggtctctgctccaagtctgggcccggggttcctcccaaccacagc
gaggggactttgccctattcctacaatctatgtattgcctctcattctgcaaagacagag
tttaattctctcaacctgacaccggaaatggctccccctcaggatctgctgtgtgatgat
ccttctatggttgtatgtgccagtaatgaagatcacaaaatcgcttatgacccttctttg
tcttcgcaccaagccccgcccaacacggactggcgtttctctcaggcccagagacccggc
accagcggctcccaaaatggcgatgacaccggcacctggcccaacaaccagtttgacaca
gagatgctgcaagccatgatcttggcgtccgccagtgaagctgctgatgggagctccacc
ctgggagggggtgccggcaccatgggattgagcgcccgctacggaccccagttcaccctg
cagcacgtgcccgactaccgccagaatgtctacatcccaggcagcaatgccacactgacc
aacgcagctggcaagcgggatggcaaggccccagcaggtggcaatggcaacaagaagaag
tcgggcaagaaggagaagaagtaa

DBGET integrated database retrieval system