KEGG   Homo sapiens (human): 56108Help
Entry
56108             CDS       T01001                                 

Gene name
PCDHGA7, PCDH-GAMMA-A7
Definition
(RefSeq) protocadherin gamma subfamily A, 7
  KO
K16495  protocadherin gamma subfamily A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    56108 (PCDHGA7)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Protocadherins
   56108 (PCDHGA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2 Cadherin_tail Cadherin_3 RET_CLD1
Motif
Other DBs
NCBI-GeneID: 56108
NCBI-ProteinID: NP_061743
OMIM: 606294
HGNC: 8705
Ensembl: ENSG00000253537
Vega: OTTHUMG00000163685
Pharos: Q9Y5G6(Tdark)
UniProt: Q9Y5G6
Position
5q31.3
AA seq 932 aa AA seqDB search
MAAQPRGGDYRGFFLLSILLGTPWEAWAGRILYSVSEETDKGSFVGDIAKDLGLEPRELA
ERGVRIISRGRTQLFALNQRSGSLVTAGRIDREEICAQSARCLVNFNILMEDKMNLYPID
VEIIDINDNVPRFLTEEINVKIMENTAPGVRFPLSEAGDPDVGTNSLQSYQLSPNRHFSL
AVQSGDDETKYPELVLERVLDREEERVHHLVLTASDGGDPPRSSTAHIQVTVVDVNDHTP
VFSLPQYQVTVPENVPVGTRLLTVHAIDLDEGVNGEVTYSFRKITPKLPKMFHLNSLTGE
ISTLEGLDYEETAFYEMEVQAQDGPGSLTKAKVLITVLDVNDNAPEVTMTSLSSSIPEDT
PLGTVIALFYLQDRDSGKNGEVTCTIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNI
TLKATDGGTPPLSRETHIFMQVADTNDNPPTFPHSSYSVYIAENNPRGASIFLVTAQDHD
SEDNAQITYSLAEDTIQGAPVSSYVSINSDTGVLYALQSFDYEQLRELQLRVTAHDSGDP
PLSSNMSLSLFVLDQNDNPPEILYPALPTDGSTGMELAPRSAEPGYLVTKVVAVDKDSGQ
NAWLSYLLLKASEPGLFAVGLYTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPEVLADLGSLEPSDGPYNYDLTLYLVVAVATVSCVFLAFVLVLLALRLRRWH
KSRLLQASEGGLANVPTSHFVGMDGVQAFLQTYSHEVSLTADSRKSHLIFPQPNYVDMLI
SQESCEKNDSLLTSVDFQECKENLPSIQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGS
NATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcagccgaggggcggggactacagaggattcttcctgctctccatcctcctg
gggaccccctgggaagcctgggcaggacgtattctctactccgtgtcggaggagacggac
aaagggtcctttgtgggagacatcgccaaggacctggggctggagccccgggagctggcg
gagcgcggagtccgcatcatctccagaggtaggacgcagcttttcgccctgaaccagcgc
agcggcagcttggtcactgcgggcaggatagaccgggaagagatctgcgctcagagtgcg
cggtgtctggtaaactttaacatcctgatggaagataaaatgaatctttaccctatagac
gtggaaataatagatattaatgacaacgttccaagattcttgacggaagaaataaatgta
aaaataatggagaatacagctcctggggttcggtttccgttaagcgaggctggggatcca
gatgtgggcacgaactccctccagagttaccagctcagccccaatcgccacttctccctg
gctgtgcaaagtggagacgatgaaactaagtacccggaactggtgctggagcgggtgctg
gaccgggaggaagagcgggttcaccacctggtcctcacagcctctgatggcggcgacccg
ccccgatccagcaccgcccacatccaggtgacagtggtggatgtgaatgaccacacgcct
gtcttctctctgcctcagtaccaagtaactgtccccgagaatgtgccagtgggtacaaga
ctgctcacggtacatgctatcgacctggacgagggagtcaatggggaagtgacatattct
tttcggaaaataactcctaaacttccaaagatgtttcatctgaactcgcttacaggagaa
atatcaactttagaaggattagattatgaagaaactgccttctatgaaatggaggttcag
gctcaagatggtcctggtagtctgacaaaggcaaaagtactgatcacagttttagatgta
aatgataatgctccagaagtgactatgacgtctttaagtagctcaatccctgaagacaca
cctcttgggacagtcattgctcttttctacctacaagacagagattctggaaagaatggt
gaggtgacctgcaccattccagaaaacctaccttttaaattagaaaaatcaatagataat
tattatagattggtcacaaccaaaaacttggaccgggaaacactctctttgtataacatc
acactgaaagccacagatggtggaactcctcccttgtccagggaaactcacatattcatg
caggtggcagacaccaacgataacccacccaccttcccccactcatcctactcagtctac
atcgctgagaacaaccccagaggggcctccattttcttagtgactgcacaggaccacgac
agtgaggataatgcccagatcacttattccttggccgaagacaccatccagggggctcca
gtgtcctcctatgtctccataaactctgacactggagtcctgtacgcgctgcaatccttt
gattatgagcagttgagagaactacaactaagagtgactgcacatgacagcggggacccg
cctctcagcagcaacatgtcactgagcctgttcgtgctggaccagaatgacaacccgccc
gagatcctgtacccggccctccccacagatggttctactggcatggagctggcaccccgc
tccgcagagcccggctacctggtgaccaaggtggtggcggtggacaaagattcaggccag
aacgcctggctgtcatacctcctgcttaaggccagcgagccaggactctttgcggttggg
ctgtacacgggcgaggtgcgcacggctcgggccctgctggacagagatgccctcaagcag
agcctcgtggtggccgtccaggaccacggtcagcctcctctgtcagccaccgtcacactc
accgtggctgtggctgacagcatccccgaagtcttggccgacctgggcagccttgagccc
tccgacggtccttacaactatgacctcacgttgtacctggtggtggcggtggccacagtc
tcctgcgtcttcctagccttcgtcctcgtactgctggcgctcaggctgcggcgctggcac
aagtcacgcctgctgcaggcttcagaaggtggcttggcgaacgtgcccacctcgcacttt
gtgggcatggacggggtgcaggctttcctgcagacctattcccatgaggtctccctcacc
gcggactctcggaagagtcacctgatcttcccccagcccaactatgtagacatgctcatc
agccaggagagctgtgagaaaaatgattctttgctaacatccgtagattttcaggaatgt
aaagaaaacctgccaagtattcagcaagccccgcccaacacggactggcgtttctctcag
gcccagagacccggcaccagcggctcccaaaatggcgatgacaccggcacctggcccaac
aaccagtttgacacagagatgctgcaagccatgatcttggcgtccgccagtgaagctgct
gatgggagctccaccctgggagggggtgccggcaccatgggattgagcgcccgctacgga
ccccagttcaccctgcagcacgtgcccgactaccgccagaatgtctacatcccaggcagc
aatgccacactgaccaacgcagctggcaagcgggatggcaaggccccagcaggtggcaat
ggcaacaagaagaagtcgggcaagaaggagaagaagtaa

DBGET integrated database retrieval system