KEGG   Homo sapiens (human): 56111
Entry
56111             CDS       T01001                                 

Gene name
PCDHGA4, PCDH-GAMMA-A4
Definition
(RefSeq) protocadherin gamma subfamily A, 4
  KO
K16495  protocadherin gamma subfamily A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    56111 (PCDHGA4)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Protocadherins
   56111 (PCDHGA4)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2 RET_CLD1
Other DBs
NCBI-GeneID: 56111
NCBI-ProteinID: NP_061740
OMIM: 606291
HGNC: 8702
Ensembl: ENSG00000262576
Vega: OTTHUMG00000177593
Pharos: Q9Y5G9(Tdark)
UniProt: Q9Y5G9
Position
5q31.3
AA seq 962 aa
MHFILDPEDPGAPQASTEGKPKHRRLRGGVVMAAPPARPDHTRLLQICLLLGVLVEIRAE
QILYSVFEEQEEGSVVGNIAKDLGLAPRELAERGVRIVSRGRTQLFALNPRSGTLVTAGR
IDREELCDRSPNCVTNLEILLEDTVKILRVEVEIIDVNDNPPSFGTEQREIKVAENENPG
ARFPLPEAFDPDVGVNSLQGYQLNSNGYFSLDVQSGADGIKYPELVLERALDREEEAVHH
LVLTAFDGGDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKATDP
DEGANGDVTYSFRKVRDKISQLFQLNSLSGDITILGGLDYEDSGFYDIDVEAHDGPGLRA
RSKVLVTVLDENDNAPEVTVTSLTSSVQESSSPGTVIALFNVHDSDSGGNGLVTCSIPDN
LPFTLEKTYGNYYRLLTHRTLDREEVSEYNITVTATDQGTPPLSTETHISLQVMDINDNP
PTFPHASYSAYIPENNPRGASILSMTAQDPDSGDNARITYSLAEDTFQGAPLSSYVSINS
NTGILYALCSFDYEQFRDLQLLMTASDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTFPT
DGSTGVELAPRSADSGYLVTKVVAVDRDSGQNAWLSYSLLKSSEPGLFAVGLHTGEVRTA
RALLDRDALKQRLVVVVQDHGQPPLSATVTLTVAVADSIPDVLADLGSLKPSADPDDSGL
TLYLVVAVAAVSCVFLAFVTVLLALKLRRWHKSRLLHAEGSRLAGVPASHFVGVDGVRAF
LQTYSHEVSLTADSRKSHLIFSQPSYADTLISRESCEKSEPLLITQDLLETKGDPNLQQA
PPNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGA
GTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
KK
NT seq 2889 nt   +upstreamnt  +downstreamnt
atgcactttattttggacccagaagatcctggggctcctcaggcctcgacagagggaaaa
ccgaagcacaggcgactccgcggcggggttgtaatggcggcgcctcctgctcgcccagac
cacacccggctgctccagatctgccttctcctgggggttctggtggaaatcagggccgaa
cagattctctactcggtgtttgaggagcaggaagaaggctcagtggtgggcaacatcgcc
aaggacctggggttggcgccccgggagctggcggagcgcggagtccgcatcgtctccaga
ggtaggacgcagcttttcgccctgaacccgcgcagcggcaccttggtcaccgcgggtagg
atagacagggaggagctctgcgacagatctccaaactgtgtgacaaacctggagattctt
ctagaagatacagtgaagattttgcgggtagaggtggaaataatcgatgttaatgataac
ccacccagttttgggacagaacagagggaaataaaagttgctgaaaatgaaaatcctggg
gcaagatttcctcttcctgaagcttttgatccggatgtaggtgtaaactccctgcagggt
taccagctcaactcaaacggttacttttccctggacgtgcaaagtggggccgatgggatt
aagtacccagagctggtgctggaacgcgctctagatcgcgaggaagaggcggttcaccac
ctcgttctcacggccttcgatggaggtgacccggttcgctctggcactgccaggattctc
ataatacttgtggataccaacgataatgctcccgtgttcactcagcccgagtaccacgta
agtgttcgtgagaacgttcctgtaggcactcggctactcaccgtaaaagccactgatcca
gatgaaggagccaatggagacgtgacgtattctttccggaaagtaagagacaaaatatca
cagctatttcagttgaattctctgagtggggatataacaatattggggggtctagattat
gaggactctggattctatgacatagatgtagaagcccatgatgggcctggtctccgagct
agaagcaaggtactggtgacagttctggatgaaaatgacaacgcaccagaagtcacagtt
acatctctcaccagctcagtccaggaatcttcttccccgggtacagtaattgcacttttc
aacgtgcatgacagtgactcaggaggaaatggcctagtcacatgttctattccagataat
ctgccattcacacttgaaaagacctatggaaattattatcggttgttgacacacagaaca
ctggacagggaagaagtctcagaatataacatcactgtaactgccactgaccagggaact
cctccactgtctacagaaactcatatttcactgcaagtgatggacatcaatgacaaccca
cccactttccctcatgcttcctactctgcttacattcctgaaaacaaccccagaggagcc
tccatcttatctatgactgctcaagaccctgacagtggtgacaatgcccgaatcacttac
tccctggccgaagacaccttccagggtgcacctctgtcctcctatgtctccatcaactcc
aatacagggatcctatatgctctttgctccttcgactatgagcagtttagagacctgcag
ctgctgatgacagccagtgacagtggagaccctccactcagcagcaatgtgtcactgagc
ctctttgtgctggaccagaacgacaatgtccctgagatcctgtaccccaccttccctact
gatggctccactggtgtggagctggcaccccgctccgcagattccggctacctggtgacc
aaagtggtggcagtggacagagactcaggtcagaatgcctggctgtcctacagcctactc
aagtccagcgagccgggactatttgcagtggggctgcacacaggcgaggtgcgcaccgca
cgggccctgctggacagagacgcgctcaagcagaggcttgtagtggtcgtccaggaccat
ggccagccccctctctcggccaccgtcacactcactgtggctgtggccgacagcatccca
gatgtcctggctgacttgggcagcctcaagccttcagcagacccagacgactcgggcctc
acactctatctcgtggtggcagtggccgctgtctcctgcgtcttcctggcttttgtcacg
gtgctgctagcactcaagctgagacgctggcacaagtcacgcctgcttcacgctgaaggc
agcaggttggcaggtgtgcctgcctcgcactttgtgggcgtggacggggttcgggctttc
ctgcagacctattcccacgaggtctccctcaccgcggactcgcggaagagtcacctgatc
ttctcccaacccagctatgcagacacgctcatcagccgggagagttgtgagaaaagcgag
cctcttctgataactcaggatttacttgaaacaaaaggagaccctaatcttcagcaagcc
ccgcccaacacggactggcgtttctctcaggcccagagacccggcaccagcggctcccaa
aatggcgatgacaccggcacctggcccaacaaccagtttgacacagagatgctgcaagcc
atgatcttggcgtccgccagtgaagctgctgatgggagctccaccctgggagggggtgcc
ggcaccatgggattgagcgcccgctacggaccccagttcaccctgcagcacgtgcccgac
taccgccagaatgtctacatcccaggcagcaatgccacactgaccaacgcagctggcaag
cgggatggcaaggccccagcaggtggcaatggcaacaagaagaagtcgggcaagaaggag
aagaagtaa

DBGET integrated database retrieval system