KEGG   Homo sapiens (human): 56114Help
Entry
56114             CDS       T01001                                 

Gene name
PCDHGA1, PCDH-GAMMA-A1
Definition
(RefSeq) protocadherin gamma subfamily A, 1
  KO
K16495  protocadherin gamma subfamily A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    56114 (PCDHGA1)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Protocadherins
   56114 (PCDHGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2 RET_CLD1 Cadherin_3 Cadherin_4
Motif
Other DBs
NCBI-GeneID: 56114
NCBI-ProteinID: NP_061735
OMIM: 606288
HGNC: 8696
Ensembl: ENSG00000204956
Vega: OTTHUMG00000163678
Pharos: Q9Y5H4(Tdark)
UniProt: Q9Y5H4
Position
5q31.3
AA seq 931 aa AA seqDB search
MKIQKKLTGCSRLMLLCLSLELLLEAGAGNIHYSVPEETDKGSFVGNIAKDLGLQPQELA
DGGVRIVSRGRMPLFALNPRSGSLITARRIDREELCAQSMPCLVSFNILVEDKMKLFPVE
VEIIDINDNTPQFQLEELEFKMNEITTPGTRVSLPFGQDLDVGMNSLQSYQLSSNPHFSL
DVQQGADGPQHPEMVLQSPLDREEEAVHHLILTASDGGEPVRSGTLRIYIQVVDANDNPP
AFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFHNVDHRVAQIFRLDSYTGE
ISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKVLIKVLDVNDNAPEVTITSVTTAVPENF
PPGTIIALISVHDQDSGDNGYTTCFIPGNLPFKLEKLVDNYYRLVTERTLDRELISGYNI
TITAIDQGTPALSTETHISLLVTDINDNSPVFHQDSYSAYIPENNPRGASIFSVRAHDLD
SNENAQITYSLIEDTIQGAPLSAYLSINSDTGVLYALRSFDYEQFRDMQLKVMARDSGDP
PLSSNVSLSLFLLDQNDNAPEILYPALPTDGSTGVELAPLSAEPGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADRISDILADLGSLEPSAKPNDSDLTLYLVVAAAAVSCVFLAFVIVLLAHRLRRWH
KSRLLQASGGGLASMPGSHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIFPQPNYADTLI
SQESCEKKGFLSAPQSLLEDKKEPFSQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPNN
QFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSN
ATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcagaaaaagctgactggctgcagcaggctgatgcttctgtgtctttctctg
gagctgctgttggaagctggggctgggaatattcactactcagtgccggaagagacagac
aaaggttccttcgtaggcaacatcgccaaggacctagggctgcaaccccaggagctggca
gatggcggagtccgcatcgtctccagaggtaggatgccgcttttcgctctgaatcctaga
agtggcagcttgatcaccgcgcgcaggatagaccgggaggagctctgcgctcagagcatg
ccgtgtctcgtgagttttaatatccttgttgaggataaaatgaagctttttcctgttgaa
gtagaaataattgatattaatgacaacactccccaattccagttagaggaactggagttt
aaaatgaatgaaataacgactccaggtaccagagtctcattgccttttgggcaagacctt
gatgtgggtatgaactcactccagagctaccaactcagctctaaccctcatttctccctg
gatgtgcaacagggagccgatgggcctcaacatccagagatggtgctgcagagtccctta
gacagagaagaagaagctgtccaccacctcatcctcacagcttctgatgggggtgaacca
gtccgttcagggaccctcagaatttacattcaggtggtggatgcaaatgacaatcctcca
gcatttactcaggcacaataccatataaatgtccccgaaaacgtgccgctgggtactcag
ctgctcatggtaaatgccactgaccctgatgagggagccaatggggaagtaacgtactcc
tttcacaatgtagaccacagagtggcccaaatatttcgtttagattcttacacaggagaa
atatcaaataaagaaccactagatttcgaagaatacaaaatgtattcaatggaagttcaa
gcccaggatggtgcggggctcatggctaaagttaaggtactgatcaaagttttggatgta
aatgataatgccccagaagtgaccatcacctctgtcaccactgcagttccagaaaacttt
cctcctgggaccataattgctcttatcagtgtgcatgaccaggactcaggagacaatggc
tacaccacatgtttcattcctggaaatttaccctttaaattggaaaagttagttgataat
tattaccgtttagtgactgaaagaacactggacagagaacttatctctgggtacaacatc
acaataacagcaatagaccaaggaactccagctctatctactgaaactcacatttcacta
ctagtgacagatatcaatgacaactccccagtcttccatcaggactcctactctgcctac
attcccgaaaacaaccccagaggagcctccatcttctctgtgagggcccacgacttggac
agcaatgagaatgcacaaatcacttactccctaatagaggacactatccagggggcaccc
ctatctgcctacctctccatcaactccgacactggggtcctgtatgcgctgcgatccttc
gactatgagcagttccgggacatgcaactgaaagtgatggcgcgggacagtggggatccg
cccctcagcagcaacgtgtctctcagcctattcctgctggaccagaacgacaacgcgccc
gagatcctgtaccccgccctccccacagatggttctaccggcgtggagctggcgcccctc
tccgcagagcccggctacctggtgaccaaggtggtggcggtggacagagactcgggccag
aacgcctggctgtcctaccgcctgctcaaggccagcgagccgggactcttctcggtgggt
ctgcacacgggcgaggtgcgcacggcgcgagccctgctggacagagacgcgctcaagcag
agtctcgtggtggccgtccaggaccacggccagcccccgctctccgccactgtcacgctc
accgtggccgtggccgacaggatctccgacatcctggccgacctgggcagcctcgagccc
tccgccaaacccaacgattcggacctcactctgtacctggtggtggcggcggccgcggtc
tcctgcgtcttcctggccttcgtcatcgtgctgctggcgcacaggctgcggcgctggcac
aagtcacgtctgctacaggcttcgggaggcggcttagcgagcatgcccggttcgcacttt
gtgggcgtggacggggttcgggctttcctgcagacctattcccacgaggtctccctcact
gcggactcgcggaagagccacctgattttcccccagcccaactatgcggacacactcatc
agccaggagagctgtgagaaaaagggttttctatcagcaccccagtctttacttgaagac
aaaaaggaaccattttctcagcaagccccgcccaacacggactggcgtttctctcaggcc
cagagacccggcaccagcggctcccaaaatggcgatgacaccggcacctggcccaacaac
cagtttgacacagagatgctgcaagccatgatcttggcgtccgccagtgaagctgctgat
gggagctccaccctgggagggggtgccggcaccatgggattgagcgcccgctacggaccc
cagttcaccctgcagcacgtgcccgactaccgccagaatgtctacatcccaggcagcaat
gccacactgaccaacgcagctggcaagcgggatggcaaggccccagcaggtggcaatggc
aacaagaagaagtcgggcaagaaggagaagaagtaa

DBGET integrated database retrieval system