KEGG   Homo sapiens (human): 56975Help
Entry
56975             CDS       T01001                                 

Gene name
FAM20C, DMP-4, DMP4, G-CK, GEF-CK, RNS
Definition
(RefSeq) FAM20C, golgi associated secretory pathway kinase
  KO
K21958  extracellular serine/threonine protein kinase FAM20C [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00968  Raine syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    56975 (FAM20C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56975 (FAM20C)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    56975 (FAM20C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fam20C FAM198
Motif
Other DBs
NCBI-GeneID: 56975
NCBI-ProteinID: NP_064608
OMIM: 611061
HGNC: 22140
Ensembl: ENSG00000177706
Vega: OTTHUMG00000151401
Pharos: Q8IXL6(Tbio)
UniProt: Q8IXL6
Structure
PDB: 

Position
7p22.3
AA seq 584 aa AA seqDB search
MKMMLVRRFRVLILMVFLVACALHIALDLLPRLERRGARPSGEPGCSCAQPAAEVAAPGW
AQVRGRPGEPPAASSAAGDAGWPNKHTLRILQDFSSDPSSNLSSHSLEKLPPAAEPAERA
LRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGPGGDASLLARLFEHPLYRVAVPPLTEE
DVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYS
RHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQALFKPMKQTREQETPPDFF
YFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRDVTRDKKLWRTFFISPANN
ICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWE
VDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNG
RGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQ
PHLEALDRRLRVVLKAVRDCVERNGLHSVVDDDLDTEHRAASAR
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgatgctggtgcgccggttccgcgtgctcatcctgatggtgttcctggtggcc
tgcgcgctgcacatcgccctggacctgctgcccaggctggagcgacgcggcgcgcggccc
tcgggggagcccggctgttcgtgcgcgcagcccgccgccgaggtggccgcgcccggctgg
gcccaggttcggggccgccccggggagcccccggccgcctcctccgccgccggcgacgcg
ggctggcccaacaagcacacgctccgcatcctgcaggacttcagctccgacccctcctcc
aacctctcgtcccactcgctggagaaactgccgcccgcggccgagccggccgagcgcgcc
ttgcgggggcgggatcccggcgccctaagaccccacgaccccgcgcaccggccgctgctg
cgagaccccggcccgcgtcggtccgagtcgccccccggccccggcggagacgcctccctc
ctggccaggctgttcgagcacccgctttaccgggtggcggttccgccgctcacggaggag
gacgtcctgttcaatgtgaacagcgacaccaggctcagccccaaagcggcggagaacccg
gactggccgcatgcgggtgctgaaggtgcagaattcctctcccccggggaggcggccgtg
gactcctatcccaactggctcaagttccacattggtatcaaccggtacgagctgtactcc
agacacaacccggccatcgaggccctgctgcacgacctcagctcccagaggatcaccagc
gtggccatgaagtcggggggcacgcagctgaagctcatcatgaccttccagaattacggg
caagcgctgttcaaacccatgaaacaaacgagggagcaggagacaccccctgactttttt
tatttctctgactacgagaggcacaatgcggagattgctgccttccacctggacaggatc
ctggacttccgccgggtccctcccgtggccggcaggatggtcaacatgaccaaggagatc
cgggacgtcacacgggacaagaagctctggaggaccttcttcatctctccagccaacaac
atctgcttctacggcgagtgttcctactactgctccacggagcacgccctgtgcgggaag
ccagaccagatcgagggctcgctggcggccttcctgcccgacctgtccctggccaagagg
aagacctggcggaacccttggcggcgttcctaccacaagcgcaagaaggccgagtgggag
gtggaccctgactactgcgaggaggtgaagcagacaccgccctacgacagcagccaccgc
atcctggacgtcatggacatgacgatcttcgacttcctcatgggaaacatggaccgtcac
cactacgagacttttgagaagtttgggaatgaaacgttcatcatccacttagacaatgga
agagggtttgggaagtattcgcacgacgagctctccatcctggtgccgctacagcagtgc
tgcaggatccggaagtccacctacctgcgtctgcagctcctggccaaggaggagtacaag
ctgagcctgctgatggccgagtctctgcggggggaccaggtggcacccgtgctgtaccag
ccgcacctggaggccctggaccggcggctccgcgtcgtgctaaaggccgtccgggactgc
gtggagaggaacgggctccacagcgtggtggatgacgacctggacactgagcacagagcc
gcctcggcgaggtag

DBGET integrated database retrieval system