KEGG   Homo sapiens (human): 5782Help
Entry
5782              CDS       T01001                                 

Gene name
PTPN12, PTP-PEST, PTPG1
Definition
(RefSeq) protein tyrosine phosphatase non-receptor type 12
  KO
K18024  tyrosine-protein phosphatase non-receptor type 12/18/22 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5782 (PTPN12)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5782 (PTPN12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase Y_phosphatase3 DSPc
Motif
Other DBs
NCBI-GeneID: 5782
NCBI-ProteinID: NP_002826
OMIM: 600079
HGNC: 9645
Ensembl: ENSG00000127947
Vega: OTTHUMG00000023501
Pharos: Q05209(Tchem)
UniProt: Q05209
Structure
PDB: 

Position
7q11.23
AA seq 780 aa AA seqDB search
MEQVEILRKFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVK
KNRYKDILPFDHSRVKLTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRM
IWEYNVVIIVMACREFEMGRKKCERYWPLYGEDPITFAPFKISCEDEQARTDYFIRTLLL
EFQNESRRLYQFHYVNWPDHDVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGA
ICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQL
YEIHGAQKIADGVNEINTENMVSSIEPEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPH
PVPPILTPSPPSAFPTVTTVWQDNDRYHPKPVLHMVSSEQHSADLNRNYSKSTELPGKNE
STIEQIDKKLERNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASPCIADKISKPQE
LSSDLNVGDTSQNSCVDCSVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHG
PENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNP
LHSDDSDSDERNSDGAVTQNKTNISTASATVSAATSTESISTRKVLPMSIARHNIAGTTH
SGAEKDVDVSEDSPPPLPERTPESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSE
NEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEWT
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagtggagatcctgaggaaattcatccagagggtccaggccatgaagagtcct
gaccacaatggggaggacaacttcgcccgggacttcatgcggttaagaagattgtctacc
aaatatagaacagaaaagatatatcccacagccactggagaaaaagaagaaaatgttaaa
aagaacagatacaaggacatactgccatttgatcacagccgagttaaattgacattaaag
actccttcacaagattcagactatatcaatgcaaattttataaagggcgtctatgggcca
aaagcatatgtagcaactcaaggacctttagcaaatacagtaatagatttttggaggatg
atatgggagtataatgttgtgatcattgtaatggcctgccgagaatttgagatgggaagg
aaaaaatgtgagcgctattggcctttgtatggagaagaccccataacgtttgcaccattt
aaaatttcttgtgaggatgaacaagcaagaacagactacttcatcaggacactcttactt
gaatttcaaaatgaatctcgtaggctgtatcagtttcattatgtgaactggccagaccat
gatgttccttcatcatttgattctattctggacatgataagcttaatgaggaaatatcaa
gaacatgaagatgttcctatttgtattcattgcagtgcaggctgtggaagaacaggtgcc
atttgtgccatagattatacgtggaatttactaaaagctgggaaaataccagaggaattt
aatgtatttaatttaatacaagaaatgagaacacaaaggcattctgcagtacaaacaaag
gagcaatatgaacttgttcatagagctattgcccaactgtttgaaaaacagctacaacta
tatgaaattcatggagctcagaaaattgctgatggagtgaatgaaattaacactgaaaac
atggtcagctccatagagcctgaaaaacaagattctcctcctccaaaaccaccaaggacc
cgcagttgccttgttgaaggggatgctaaagaagaaatactgcagccaccggaacctcat
ccagtgccacccatcttgacaccttctcccccttcagcttttccaacagtcactactgtg
tggcaggacaatgatagataccatccaaagccagtgttgcatatggtttcatcagaacaa
cattcagcagacctcaacagaaactatagtaaatcaacagaacttccagggaaaaatgaa
tcaacaattgaacagatagataaaaaattggaacgaaatttaagttttgagattaagaag
gtccctctccaagagggaccaaaaagttttgatgggaacacacttttgaataggggacat
gcaattaaaattaaatctgcttcaccttgtatagctgataaaatctctaagccacaggaa
ttaagttcagatctaaatgtcggtgatacttcccagaattcttgtgtggactgcagtgta
acacaatcaaacaaagtttcagttactccaccagaagaatcccagaattcagacacacct
ccaaggccagaccgcttgcctcttgatgagaaaggacatgtaacgtggtcatttcatgga
cctgaaaatgccatacccatacctgatttatctgaaggcaattcctcagatatcaactat
caaactaggaaaactgtgagtttaacaccaagtcctacaacacaagttgaaacacctgat
cttgtggatcatgataacacttcaccactcttcagaacacccctcagttttactaatcca
cttcactctgatgactcagactcagatgaaagaaactctgatggtgctgtgacccagaat
aaaactaatatttcaacagcaagtgccacagtttctgctgccactagtactgaaagcatt
tctactaggaaagtattgccaatgtccattgctagacataatatagcaggaacaacacat
tcaggtgctgaaaaagatgttgatgttagtgaagattcacctcctcccctacctgaaaga
actcctgaatcgtttgtgttagcaagtgaacataatacacctgtaagatcggaatggagt
gaacttcaaagtcaggaacgatctgaacaaaaaaagtctgaaggcttgataacctctgaa
aatgagaaatgtgatcatccagcgggaggtattcactatgaaatgtgcatagaatgtcca
cctactttcagtgacaagagagaacaaatatcagaaaatccaacagaagccacagatatt
ggttttggtaatcgatgtggaaaacccaaaggaccaagagatccaccttcagaatggaca
tga

DBGET integrated database retrieval system