KEGG   Homo sapiens (human): 580Help
Entry
580               CDS       T01001                                 

Gene name
BARD1
Definition
(RefSeq) BRCA1 associated RING domain 1
  KO
K10683  BRCA1-associated RING domain protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    580 (BARD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    580 (BARD1)
   04121 Ubiquitin system [BR:hsa04121]
    580 (BARD1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    580 (BARD1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     580 (BARD1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    580 (BARD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     580 (BARD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_6 Ank_2 Ank_4 Ank_5 Ank Ank_3 BRCT_2 BRCT zf-RING_5 zf-C3HC4 Siva zf-C3HC4_3 zf-RING_UBOX zf-RING_2
Motif
Other DBs
NCBI-GeneID: 580
NCBI-ProteinID: NP_000456
OMIM: 601593
HGNC: 952
Ensembl: ENSG00000138376
Vega: OTTHUMG00000133016
Pharos: Q99728(Tbio)
UniProt: Q99728 A0AVN2
Structure
PDB: 

Position
2q35
AA seq 777 aa AA seqDB search
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREP
VCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNEL
SDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSY
EFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLV
SFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTP
EKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLP
ECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELL
LQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMK
SLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEF
DSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRS
RLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV
AYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgccggataatcggcagccgaggaaccggcagccgaggatccgctccgggaacgagcct
cgttccgcgcccgccatggaaccggatggtcgcggtgcctgggcccacagtcgcgccgcg
ctcgaccgcctggagaagctgctgcgctgctcgcgttgtactaacattctgagagagcct
gtgtgtttaggaggatgtgagcacatcttctgtagtaattgtgtaagtgactgcattgga
actggatgtccagtgtgttacaccccggcctggatacaagacttgaagataaatagacaa
ctggacagcatgattcaactttgtagtaagcttcgaaatttgctacatgacaatgagctg
tcagatttgaaagaagataaacctaggaaaagtttgtttaatgatgcaggaaacaagaag
aattcaattaaaatgtggtttagccctcgaagtaagaaagtcagatatgttgtgagtaaa
gcttcagtgcaaacccagcctgcaataaaaaaagatgcaagtgctcagcaagactcatat
gaatttgtttccccaagtcctcctgcagatgtttctgagagggctaaaaaggcttctgca
agatctggaaaaaagcaaaaaaagaaaactttagctgaaatcaaccaaaaatggaattta
gaggcagaaaaagaagatggtgaatttgactccaaagaggaatctaagcaaaagctggta
tccttctgtagccaaccatctgttatctccagtcctcagataaatggtgaaatagactta
ctagcaagtggctccttgacagaatctgaatgttttggaagtttaactgaagtctcttta
ccattggctgagcaaatagagtctccagacactaagagcaggaatgaagtagtgactcct
gagaaggtctgcaaaaattatcttacatctaagaaatctttgccattagaaaataatgga
aaacgtggccatcacaatagactttccagtcccatttctaagagatgtagaaccagcatt
ctgagcaccagtggagattttgttaagcaaacggtgccctcagaaaatataccattgcct
gaatgttcttcaccaccttcatgcaaacgtaaagttggtggtacatcagggaggaaaaac
agtaacatgtccgatgaattcattagtctttcaccaggtacaccaccttctacattaagt
agttcaagttacaggcgagtgatgtctagtccctcagcaatgaagctgttgcccaatatg
gctgtgaaaagaaatcatagaggagagactttgctccatattgcttctattaagggcgac
ataccttctgttgaataccttttacaaaatggaagtgatccaaatgttaaagaccatgct
ggatggacaccattgcatgaagcttgcaatcatgggcacctgaaggtagtggaattattg
ctccagcataaggcattggtgaacaccaccgggtatcaaaatgactcaccacttcacgat
gcagccaagaatgggcatgtggatatagtcaagctgttactttcctatggagcctccaga
aatgctgttaatatatttggtctgcggcctgtcgattatacagatgatgaaagtatgaaa
tcgctattgctgctaccagagaagaatgaatcatcctcagctagccactgctcagtaatg
aacactgggcagcgtagggatggacctcttgtacttataggcagtgggctgtcttcagaa
caacagaaaatgctcagtgagcttgcagtaattcttaaggctaaaaaatatactgagttt
gacagtacagtaactcatgttgttgttcctggtgatgcagttcaaagtaccttgaagtgt
atgcttgggattctcaatggatgctggattctaaaatttgaatgggtaaaagcatgtcta
cgaagaaaagtatgtgaacaggaagaaaagtatgaaattcctgaaggtccacgcagaagc
aggctcaacagagaacagctgttgccaaagctgtttgatggatgctacttctatttgtgg
ggaaccttcaaacaccatccaaaggacaaccttattaagctcgtcactgcaggtgggggc
cagatcctcagtagaaagcccaagccagacagtgacgtgactcagaccatcaatacagtc
gcataccatgcgagacccgattctgatcagcgcttctgcacacagtatatcatctatgaa
gatttgtgtaattatcacccagagagggttcggcagggcaaagtctggaaggctccttcg
agctggtttatagactgtgtgatgtcctttgagttgcttcctcttgacagctga

DBGET integrated database retrieval system