KEGG   Homo sapiens (human): 5925Help
Entry
5925              CDS       T01001                                 

Gene name
RB1, OSRC, PPP1R130, RB, p105-Rb, pRb, pp110
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04934  Cushing's syndrome
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00692  Cell cycle - G1/S transition
Network
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00074  Loss of RB1 to cell cycle G1/S
N00075  Mutation-inactivated RB1 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00167  KSHV vIRF1/3 to p21-cell cycle G1/S
N00168  KSHV vCyclin to cell cycle G1/S
N00169  KSHV LANA to p21-cell cycle G1/S
N00170  KSHV LANA to cell cycle G1/S
N00194  HPV E7 to host-cell-protein activation
N00204  KSHV LANA to host-cell-protein activation
N00222  HTLV-I Tax to host-cell-protein inhibition
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00255  Amplified CCNE to cell cycle G1/S
N00275  Amplified CCND1 to cell cycle G1/S
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
Disease
H00004  Chronic myeloid leukemia (CML)
H00013  Small cell lung cancer
H00017  Esophageal cancer
H00022  Bladder cancer
H00036  Osteosarcoma
H00042  Glioma
H00048  Hepatocellular carcinoma
H01513  Retinoblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5925 (RB1)
   04218 Cellular senescence
    5925 (RB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5925 (RB1)
   05203 Viral carcinogenesis
    5925 (RB1)
   05212 Pancreatic cancer
    5925 (RB1)
   05225 Hepatocellular carcinoma
    5925 (RB1)
   05226 Gastric cancer
    5925 (RB1)
   05214 Glioma
    5925 (RB1)
   05220 Chronic myeloid leukemia
    5925 (RB1)
   05218 Melanoma
    5925 (RB1)
   05219 Bladder cancer
    5925 (RB1)
   05215 Prostate cancer
    5925 (RB1)
   05224 Breast cancer
    5925 (RB1)
   05222 Small cell lung cancer
    5925 (RB1)
   05223 Non-small cell lung cancer
    5925 (RB1)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    5925 (RB1)
  Infectious diseases
   05166 HTLV-I infection
    5925 (RB1)
   05161 Hepatitis B
    5925 (RB1)
   05163 Human cytomegalovirus infection
    5925 (RB1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    5925 (RB1)
   05169 Epstein-Barr virus infection
    5925 (RB1)
   05165 Human papillomavirus infection
    5925 (RB1)
  Drug resistance
   01522 Endocrine resistance
    5925 (RB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5925 (RB1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    5925 (RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Motif
Other DBs
NCBI-GeneID: 5925
NCBI-ProteinID: NP_000312
OMIM: 614041
HGNC: 9884
Ensembl: ENSG00000139687
Vega: OTTHUMG00000016900
Pharos: P06400(Tchem)
UniProt: P06400 A0A024RDV3
Structure
PDB: 

Position
13q14.2
AA seq 928 aa AA seqDB search
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgaaaaacggccgccaccgccgccgctgccgccgcggaaccc
ccggcaccgccgccgccgccccctcctgaggaggacccagagcaggacagcggcccggag
gacctgcctctcgtcaggcttgagtttgaagaaacagaagaacctgattttactgcatta
tgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaa
gtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaggaactgtgggga
atctgtatctttattgcagcagttgacctagatgagatgtcgttcacttttactgagcta
cagaaaaacatagaaatcagtgtccataaattctttaacttactaaaagaaattgatacc
agtaccaaagttgataatgctatgtcaagactgttgaagaagtatgatgtattgtttgca
ctcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagttcg
atatctactgaaataaattctgcattggtgctaaaagtttcttggatcacatttttatta
gctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgcta
tgtgtccttgactattttattaaactctcacctcccatgttgctcaaagaaccatataaa
acagctgttatacccattaatggttcacctcgaacacccaggcgaggtcagaacaggagt
gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatg
aattctcttggacttgtaacatctaatggacttccagaggttgaaaatctttctaaacga
tacgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgat
aaaactcttcagactgattctatagacagttttgaaacacagagaacaccacgaaaaagt
aaccttgatgaagaggtgaatgtaattcctccacacactccagttaggactgttatgaac
actatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaatctg
atttcctattttaacaactgcacagtgaatccaaaagaaagtatactgaaaagagtgaag
gatataggatacatctttaaagagaaatttgctaaagctgtgggacagggttgtgtcgaa
attggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatg
cttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgacaac
atttttcatatgtctttattggcgtgcgctcttgaggttgtaatggccacatatagcaga
agtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaatgtg
cttaatttaaaagcctttgatttttacaaagtgatcgaaagttttatcaaagcagaaggc
aacttgacaagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatcc
cttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaa
ggaccaactgatcaccttgaatctgcttgtcctcttaatcttcctctccagaataatcac
actgcagcagatatgtatctttctcctgtaagatctccaaagaaaaaaggttcaactacg
cgtgtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaag
ccattgaaatctacctctctttcactgttttataaaaaagtgtatcggctagcctatctc
cggctaaatacactttgtgaacgccttctgtctgagcacccagaattagaacatatcatc
tggacccttttccagcacaccctgcagaatgagtatgaactcatgagagacaggcatttg
gaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa
ttcaaaatcattgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa
cgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtcttc
atgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtca
ccaatacctcacattcctcgaagcccttacaagtttcctagttcacccttacggattcct
ggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctgcca
acaccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcattcggg
acttctgagaagttccagaaaataaatcagatggtatgtaacagcgaccgtgtgctcaaa
agaagtgctgaaggaagcaaccctcctaaaccactgaaaaaactacgctttgatattgaa
ggatcagatgaagcagatggaagtaaacatctcccaggagagtccaaatttcagcagaaa
ctggcagaaatgacttctactcgaacacgaatgcaaaagcagaaaatgaatgatagcatg
gatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system