KEGG   Homo sapiens (human): 5996
Entry
5996              CDS       T01001                                 
Symbol
RGS1, 1R20, BL34, HEL-S-87, IER1, IR20
Name
(RefSeq) regulator of G protein signaling 1
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    5996 (RGS1)
SSDB
Motif
Pfam: RGS
Other DBs
NCBI-GeneID: 5996
NCBI-ProteinID: NP_002913
OMIM: 600323
HGNC: 9991
Ensembl: ENSG00000090104
Pharos: Q08116(Tbio)
UniProt: Q08116
Structure
Position
1:192575773..192580024
AA seq 209 aa
MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPH
LESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACED
YKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT
LMEKDSYPRFLKSDIYLNLLNDLQANSLK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgcgcgcagcagccatctccactccaaagttagacaaaatgccaggaatgttcttctct
gctaacccaaaggaattgaaaggaaccactcattcacttctagacgacaaaatgcaaaaa
aggaggccaaagacttttggaatggatatgaaagcatacctgagatctatgatcccacat
ctggaatctggaatgaaatcttccaagtccaaggatgtactttctgctgctgaagtaatg
caatggtctcaatctctggaaaaacttcttgccaaccaaactggtcaaaatgtctttgga
agtttcctaaagtctgaattcagtgaggagaatattgagttctggctggcttgtgaagac
tataagaaaacagagtctgatcttttgccctgtaaagcagaagagatatataaagcattt
gtgcattcagatgctgctaaacaaatcaatattgacttccgcactcgagaatctacagcc
aagaagattaaagcaccaacccccacgtgttttgatgaagcacaaaaagtcatatatact
cttatggaaaaggactcttatcccaggttcctcaaatcagatatttacttaaatcttcta
aatgacctgcaggctaatagcctaaagtga

DBGET integrated database retrieval system