KEGG   Homo sapiens (human): 6120Help
Entry
6120              CDS       T01001                                 

Gene name
RPE, RPE2-1
Definition
(RefSeq) ribulose-5-phosphate-3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00030  Pentose phosphate pathway
hsa00040  Pentose and glucuronate interconversions
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hsa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6120 (RPE)
   00040 Pentose and glucuronate interconversions
    6120 (RPE)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     6120 (RPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C OMPdecase IGPS His_biosynth
Motif
Other DBs
NCBI-GeneID: 6120
NCBI-ProteinID: NP_954699
OMIM: 180480
HGNC: 10293
Ensembl: ENSG00000197713
Vega: OTTHUMG00000154690
Pharos: Q96AT9(Tbio)
UniProt: Q96AT9
Structure
PDB: 

Position
2q34
AA seq 228 aa AA seqDB search
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggctgcaagattggcccgtccatcctcaacagcgacctggccaatttaggg
gccgagtgcctccggatgctagactctggggccgattatctgcacctggacgtaatggac
gggcattttgttcccaacatcacctttggtcaccctgtggtagaaagccttcgaaagcag
ctaggccaggaccctttctttgacatgcacatgatggtgtccaagccagaacagtgggta
aagccaatggctgtagcaggagccaatcagtacacctttcatctcgaggctactgagaac
ccaggggctttgattaaagacattcgggagaatgggatgaaggttggccttgccatcaaa
ccaggaacctcagttgagtatttggcaccatgggctaatcagatagatatggccttggtt
atgacagtggaaccggggtttggagggcagaaattcatggaagatatgatgccaaaggtt
cactggttgaggacccagttcccatctttggatatagaggtcgatggtggagtaggtcct
gacactgtccataaatgtgcagaggcaggagctaacatgattgtgtctggcagtgctatt
atgaggagtgaagaccccagatctgtgatcaatctattaagaaatgtttgctcagaagct
gctcagaaacgttctcttgatcggtga

DBGET integrated database retrieval system