KEGG   Homo sapiens (human): 6273Help
Entry
6273              CDS       T01001                                 

Gene name
S100A2, CAN19, S100L
Definition
(RefSeq) S100 calcium binding protein A2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: S_100 EF-hand_7 EF-hand_4 EF-hand_1 DUF1160
Motif
Other DBs
NCBI-GeneID: 6273
NCBI-ProteinID: NP_005969
OMIM: 176993
HGNC: 10492
Ensembl: ENSG00000196754
Vega: OTTHUMG00000035031
Pharos: P29034(Tbio)
UniProt: P29034
Structure
PDB: 

Position
1q21.3
AA seq 98 aa AA seqDB search
MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLM
GSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgcagttctctggagcaggcgctggctgtgctggtcactaccttccacaagtac
tcctgccaagagggcgacaagttcaagctgagtaagggggaaatgaaggaacttctgcac
aaggagctgcccagctttgtgggggagaaagtggatgaggaggggctgaagaagctgatg
ggcagcctggatgagaacagtgaccagcaggtggacttccaggagtatgctgttttcctg
gcactcatcactgtcatgtgcaatgacttcttccagggctgcccagaccgaccctga

DBGET integrated database retrieval system