KEGG   Homo sapiens (human): 6362Help
Entry
6362              CDS       T01001                                 

Gene name
CCL18, AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18
Definition
(RefSeq) C-C motif chemokine ligand 18
  KO
K21094  C-C motif chemokine 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6362 (CCL18)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6362 (CCL18)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6362 (CCL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6362
NCBI-ProteinID: NP_002979
OMIM: 603757
HGNC: 10616
Ensembl: ENSG00000275385
Vega: OTTHUMG00000188410
Pharos: P55774(Tbio)
UniProt: P55774
Structure
PDB: 

Position
17q12
AA seq 89 aa AA seqDB search
MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI
LLTKRGRQICADPNKKWVQKYISDLKLNA
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaagggccttgcagctgccctccttgtcctcgtctgcaccatggccctctgctcctgt
gcacaagttggtaccaacaaagagctctgctgcctcgtctatacctcctggcagattcca
caaaagttcatagttgactattctgaaaccagcccccagtgccccaagccaggtgtcatc
ctcctaaccaagagaggccggcagatctgtgctgaccccaataagaagtgggtccagaaa
tacatcagcgacctgaagctgaatgcctga

DBGET integrated database retrieval system