KEGG   Homo sapiens (human): 6497Help
Entry
6497              CDS       T01001                                 

Gene name
SKI, SGS, SKV
Definition
(RefSeq) SKI proto-oncogene
Organism
hsa  Homo sapiens (human)
Disease
H00659  Shprintzen-Goldberg syndrome
SSDB OrthologParalogGFIT
Motif
Pfam: Ski_Sno c-SKI_SMAD_bind AAA_13
Motif
Other DBs
NCBI-GeneID: 6497
NCBI-ProteinID: NP_003027
OMIM: 164780
HGNC: 10896
Ensembl: ENSG00000157933
Vega: OTTHUMG00000001407
Pharos: P12755(Tbio)
UniProt: P12755
Structure
PDB: 

Position
1p36.33-p36.32
AA seq 728 aa AA seqDB search
MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAV
PAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKR
LCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKT
DAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSP
SAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARL
GRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWLRTLA
GSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVA
LAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDS
EAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEA
ELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKE
KLREATEAKRNLRKEIERLRAENEKKMKEANESRLRLKRELEQARQARVCDKGCEAGRLR
AKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEKVVKELQEQLWPRARPEAAGS
EGAAELEP
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggcaggcggccgcggctgtttccagccgcacccggggctgcagaagacg
ctggagcagttccacctgagctccatgagctcgctgggcggcccggccgctttctcggcg
cgctgggcgcaggaggcctacaagaaggagagcgccaaggaggcgggcgcggccgcggtg
ccggcgccggtgcccgcagccaccgagccgccgcccgtgctgcacctgcccgccatccag
ccgccgccgcccgtgctgcccgggcccttcttcatgccgtccgaccgctccaccgagcgc
tgcgagaccgtactggaaggcgagaccatctcgtgcttcgtggtgggaggcgagaagcgc
ctgtgtctgccgcagattctcaactcggtgctgcgcgacttctcgctgcagcagatcaac
gcggtgtgcgacgagctccacatctactgctcgcgctgcacggccgaccagctggagatc
ctcaaagtcatgggcatcctgcccttctcggcgccctcgtgcgggctcatcaccaagacg
gacgccgagcgcctgtgcaacgcgctgctctacggcggcgcctacccgccgccctgcaag
aaggagctggccgccagcctggcgctgggcctggagctcagcgagcgcagcgtccgcgtg
taccacgagtgcttcggcaagtgtaaggggctgctggtgcccgagctctacagcagcccg
agcgccgcctgcatccagtgcctggactgccgcctcatgtacccgccgcacaagttcgtg
gtgcactcgcacaaggccctggagaaccggacctgccactggggcttcgactcggccaac
tggcgggcctacatcctgctgagccaggattacacgggcaaggaggagcaggcgcgcctc
ggccgctgcctggacgacgtgaaggagaaattcgactatggcaacaagtacaagcggcgg
gtgccccgggtctcctctgagcctccggcctccataagacccaaaacagatgacacctct
tcccagtcccccgcgccttccgaaaaggacaagccgtccagctggctgcggaccttggcc
ggctcttccaataagagcctgggctgtgttcaccctcgccagcgcctctctgctttccga
ccctggtcccccgcagtgtcagcgagtgagaaagagctctccccacacctcccggccctc
atccgagacagcttctactcctacaagagctttgagacagccgtggcgcccaacgtggcc
ctcgcaccgccggcccagcagaaggttgtgagcagccctccgtgtgccgccgccgtctcc
cgggcccccgagcctctcgccacttgcacccagcctcggaagcggaagctgactgtggac
accccaggagccccagagacgctggcgcccgtggctgccccagaggaggacaaggactcg
gaggcggaggtggaagttgaaagcagggaggaattcacctcctccttgtcctcgctctct
tccccgtcctttacctcatccagctccgccaaggacctgggctccccgggtgcgcgtgcc
ctgccctcggccgtccctgatgctgcggcccctgccgacgcccccagtgggctggaggcg
gagctggagcacctgcggcaggcactggagggcggcctggacaccaaggaagccaaagag
aagttcctgcatgaggtggtcaagatgcgcgtgaagcaggaggagaagctcagcgcagcc
ctgcaggccaagcgcagcctccaccaggagctggagttcctacgcgtggccaagaaggag
aagctgcgggaggccacggaggccaagcgtaacctgcggaaggagatcgagcgtctccgc
gccgagaacgagaagaagatgaaagaggccaacgagtcacggctgcgcctgaagcgggag
ctggagcaggcgcggcaggcccgggtgtgcgacaagggctgcgaggcgggccgcctgcgc
gccaagtactcggcccagatcgaagacctgcaggtgaagctgcagcacgcggaggcggac
cgggagcagctgcgggccgacctgctgcgggagcgcgaggcccgggagcacctggagaag
gtggtgaaggagctgcaggaacagctgtggccgcgggcccgccccgaggctgcgggcagc
gagggcgctgcggagctggagccgtag

DBGET integrated database retrieval system