KEGG   Homo sapiens (human): 6535
Entry
6535              CDS       T01001                                 

Symbol
SLC6A8, CCDS1, CRT, CRTR, CT1, CTR5
Name
(RefSeq) solute carrier family 6 member 8
  KO
K05041  solute carrier family 6 (neurotransmitter transporter, creatine) member 8
Organism
hsa  Homo sapiens (human)
Disease
H00849  Cerebral creatine deficiency syndrome
H02196  X-linked creatine deficiency syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6535 (SLC6A8)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6535 (SLC6A8)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 6535
NCBI-ProteinID: NP_005620
OMIM: 300036
HGNC: 11055
Ensembl: ENSG00000130821
Vega: OTTHUMG00000024208
Pharos: P48029(Tbio)
UniProt: P48029 X5D9C4
Position
X:153687926..153696593
AA seq 635 aa
MAKKSAENGIYSVSGDEKKGPLIAPGPDGAPAKGDGPVGLGTPGGRLAVPPRETWTRQMD
FIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGS
INVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPD
CVEIFRHEDCANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLL
ACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIYYLKPDWSKL
GSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVF
SILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFV
GVEGFITGLLDLLPASYYFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASG
TTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVV
YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWG
LHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggcgaagaagagcgccgagaacggcatctatagcgtgtccggcgacgagaagaagggc
cccctcatcgcgcccgggcccgacggggccccggccaagggcgacggccccgtgggcctg
gggacacccggcggccgcctggccgtgccgccgcgcgagacctggacgcgccagatggac
ttcatcatgtcgtgcgtgggcttcgccgtgggcttgggcaacgtgtggcgcttcccctac
ctgtgctacaagaacggcggaggtgtgttccttattccctacgtcctgatcgccctggtt
ggaggaatccccattttcttcttagagatctcgctgggccagttcatgaaggccggcagc
atcaatgtctggaacatctgtcccctgttcaaaggcctgggctacgcctccatggtgatc
gtcttctactgcaacacctactacatcatggtgctggcctggggcttctattacctggtc
aagtcctttaccaccacgctgccctgggccacatgtggccacacctggaacactcccgac
tgcgtggagatcttccgccatgaagactgtgccaatgccagcctggccaacctcacctgt
gaccagcttgctgaccgccggtcccctgtcatcgagttctgggagaacaaagtcttgagg
ctgtctgggggactggaggtgccaggggccctcaactgggaggtgaccctttgtctgctg
gcctgctgggtgctggtctacttctgtgtctggaagggggtcaaatccacgggaaagatc
gtgtacttcactgctacattcccctacgtggtcctggtcgtgctgctggtgcgtggagtg
ctgctgcctggcgccctggatggcatcatttactatctcaagcctgactggtcaaagctg
gggtcccctcaggtgtggatagatgcggggacccagattttcttttcttacgccattggc
ctgggggccctcacagccctgggcagctacaaccgcttcaacaacaactgctacaaggac
gccatcatcctggctctcatcaacagtgggaccagcttctttgctggcttcgtggtcttc
tccatcctgggcttcatggctgcagagcagggcgtgcacatctccaaggtggcagagtca
gggccgggcctggccttcatcgcctacccgcgggctgtcacgctgatgccagtggcccca
ctctgggctgccctgttcttcttcatgctgttgctgcttggtctcgacagccagtttgta
ggtgtggagggcttcatcaccggcctcctcgacctcctcccggcctcctactacttccgt
ttccaaagggagatctctgtggccctctgttgtgccctctgctttgtcatcgatctctcc
atggtgactgatggcgggatgtacgtcttccagctgtttgactactactcggccagcggc
accaccctgctctggcaggccttttgggagtgcgtggtggtggcctgggtgtacggagct
gaccgcttcatggacgacattgcctgtatgatcgggtaccgaccttgcccctggatgaaa
tggtgctggtccttcttcaccccgctggtctgcatgggcatcttcatcttcaacgttgtg
tactacgagccgctggtctacaacaacacctacgtgtacccgtggtggggtgaggccatg
ggctgggccttcgccctgtcctccatgctgtgcgtgccgctgcacctcctgggctgcctc
ctcagggccaagggcaccatggctgagcgctggcagcacctgacccagcccatctggggc
ctccaccacttggagtaccgagctcaggacgcagatgtcaggggcctgaccaccctgacc
ccagtgtccgagagcagcaaggtcgtcgtggtggagagtgtcatgtga

DBGET integrated database retrieval system