KEGG   Homo sapiens (human): 6726
Entry
6726              CDS       T01001                                 
Symbol
SRP9, ALURBP
Name
(RefSeq) signal recognition particle 9
  KO
K03109  signal recognition particle subunit SRP9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    6726 (SRP9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    6726 (SRP9)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   6726 (SRP9)
SSDB
Motif
Pfam: SRP9-21
Other DBs
NCBI-GeneID: 6726
NCBI-ProteinID: NP_003124
OMIM: 600707
HGNC: 11304
Ensembl: ENSG00000143742
Pharos: P49458(Tbio)
UniProt: P49458
Structure
Position
1:225777826..225790464
AA seq 86 aa
MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVK
KIEKFHSQLMRLMVAKEARNVTMETE
NT seq 261 nt   +upstreamnt  +downstreamnt
atgccgcagtaccagacctgggaggagttcagccgcgctgccgagaagctttacctcgct
gaccctatgaaggcacgtgtggttctcaaatataggcattctgatgggaacttgtgtgtt
aaagtaacagatgatttagtttgtttggtgtataaaacagaccaagctcaagatgtaaag
aagattgagaaattccacagtcaactaatgcgacttatggtagccaaggaagcccgcaat
gttaccatggaaactgagtga

DBGET integrated database retrieval system